Gabrielle M.

Pres Blood Jesus, ItPg, HlSpt, HFJ, JKAN, Jesus EchLrd SHJ IHM, OLL, OLF, OLV, OLG, OLGC, OLGR, OLGS, OLMM, OLMC, Jesus Divine Physician, OLS all Holy men & wmn in hvn & earth, all Grdn Arch Seraph & Cherub Power Thrones Dominion Angels Sts Pio, Athy, Expd, Jsph, Ann, More, Christr, Paul, Bosco, Arch Bishop Fulton Sheen, Mother Angelica, Bishop Schmitt, my deceased family members in purgatory, all souls in purgatory, Lucy, Mcl Gbrl Rphl, Dyn, Rita, Thrs Lsx, MG, Nicls, BslJohn Bapt, Mta, TA, JA, Peter, Luke, 3 kings wise men, Mthw, Mark, John, Isdr(s) CthAlx,Clare, Frncs Assisii & Jude Please adopt Victoria as your spiritual child pray for V si & all of Vs intentions, Bless pour out blsgs protect provide guide heal replenish prtz fv hghst & best for V V improve & Godly sanctify in abdc Victoria all of V’s intentions, all of V’s: income, prosperity in every ways, hdifslpdmihidtgrpppsficpidrpsimowhphiriiiisiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiifiivsiiiiiiiiiiiiclrty fv siihealings, special intentions, home, level headedness, clarity, understanding, peace, calm, love, car, btrhth & btrptn, career, purity, chastity, mdi, souls in purgatory, my deceased members of my family in purgatory, love, hhbi, sii, love, stability, security, special intentions, peace of mind and body, love, children’s books, bkcntiedsi spgrtnsiagent, publr, EMBSPH hlgsiifor V and SJiiii, understanding, faith, hope, joy, self control, provide for all of my needs just for today Jesus and keep me from stain of sin just for today, peace in my families and godly relationships, peace in V community WV USA and on earth, special intentions, ccqfii fv, love, joy, peace, sii,k love, sii, godliness temporal legal dating career professional personal financial retirement car cmm fix V car affordably agent attny’s md healing publisher safe travel krggsutgc apt insptc storage rmnt prtytx lcsi si wrtg childrens Chrstn books sltxi emplymnti si good luck good fortune prosperity sfawatntsisi rep ed hlgsi vlpi si dci happy unions sisi car love si drpcpisi mowcrtiihdfslpdmimowiiiiiiiiiiiiiiiiiihriivpskncrhrcrsimticrbblkrclalniiiiiiiiiiiiihphihlwiiiiimowiihdfslpdmiiimowiifv merciesaisi, siiiiiippfv, love, special intentionsiii fv and mercies si, mowi dshfrtcmptr iiiiihredhlw btr health and healings si spg rtn ex sltxirsntltrs bkcy tmprl se lsk hlthins hp si dsb&dsbmn si siifv ii,si, hdfslpdmaaazmfi favors mercies si, love, godly real siii friends family church community stii Special Intentions & Petitions, safe travel, mindfulness, siiiiifv, love, si, justicei, mercies, love, si, love, calm, love, si, gentleness, joy, peace, love, EMBSPH healings, stability, love, my guardian angel all Arch angels Saints Angels and Virgin Mary thank you and blessings, love, si, ii, love, prosperity, love, si, gentleness, sppts love, special intentions, V repiisi fv, calm, virtues I need most, siifv security, peace of mind and body, peace, happiness, car cmm rtmnt IRS TXNTLTRS sisiftr fv, love, calm, peace, dntlclng si msgigrtsii fv, sii, good fortune, prosperity, income and financial blessings, fntlcng good health and healings, goodness, kindness, peace, peace of mind and body, jsi, mercy, spclints orgz V apt lf strg siiifv, temporal legal spiritual financial income career professional personal dtg rp retirement favors, si, love, happy unions prosperity, love,siretirement favors, love, special intentions and petitions, relief from pain, hope and inspiriation, sii, sell 7,777 of V’s books per year siifv, body and spiritual well being, help V lose 35 lbs and inches sii fv, love, help with financial difficulties, help with difficult decisionsi, ctrl tng, sii clphn iiifv, lglcs atatf lgl bkcy siiifv mercies, love, spppts fv, si help V to downsize orgz strg sii fv, help V eat high prtn high fbr frsh vgtbls frsh frt little or no refine sugar little and low carbs sii low lactose lactose free eat 1000 calories per day burn 400 cl per day si fv mercies daily, V’s shpg rtn ex sii fv si, 20/20 vsn, spclints, spclintsiii fv, spclints hope faith mrecy jsii lglcsmlisiii txiiilgllglcsatatf siifv iiimrcs, rpnshsfvpatintdrpiedhrcrblccnpskncgssiihgi mercies favors si, thank you, frtdsintclphmfelmf favors and mercies si, self control, love, Special Intentions & Petitions, iictltng, chbkscrdtgfn to take off fvi , strengthen heal & make whole in body mind & soul V filled with PBJ V sii, dtg, Special Petitions & Intentions, cut cords not best 4 V & help V form healthy godly attachments siifv merciesi ent cpns, good luck, good fortune, self control, ovcmtp, hopesiispgtrniifv, love, reali =yoked pure chst lvg faithful Ctci cute mascln godly gentleman husband similar to St Josephi bring us tgthr on wings of Gods Angels & let him be happy about it fvii, i, clarity, happy death, happy life, heal my DAD spclintsisii sppts, Special Intentions, hope, curb V appetite raise V metabolic rate si si fv, financial blessings and favors, Special Intentinos, Special Petitons, Special Intentions, purt on V full armor of God 24.7.365, Special Intentions, Special Petitions, Special Intentions, sppts, cloak V with the cloak bp of St patric 24.7.365 fv mercies, Special Intentions si, mercy, happiness, sppts, Special Intentions Special Intentions, Special Intentions, Special Intentions, Special Intentions, Special Intentions, forgiveness si, spclints, spclints spclints, love, Special intentions, peace, Special Intentions, love, V’s written petitions and daily offering prayer ministry bag candle OSST DM HSS SU OLL MH all cndlv&r si Eucharistic Adoration wrtn and oral pt OMPH TL rsy ms nvna ptns sii fv mercies si, reparation for V sin and sin in the world, healings si fv, spclints, faith, ctrl tng, sii, mindfulness, temporal and legal fv, spclintssi hlwmgcisi fv, V paperwork sii fv, Special Intentions, heal V brn cncni heck wl eyes back foot skni fv mercies V lpiiifv mercies, si, spclints, love, Souls in purgatory, si, Special intentions, V’s happy healthy godly stable secure grace filled fti marriage home/married careers children retmnt life sii fv, love, temporal favors, peace, spclints spclints, si, love, sii,retirement bkcy gciifv awcbiskncrntathredazhlwdsftclphncmptreddrpinssfmf fv krggsutand cmm, V’s written petitions & daily offering prayer ministry bag DM SU HSS 13 MH TL CAMMOSST OMPH OLL wrtn & oral Erst Adstntli pts rsy msn nv pry tlpry prycrcl crcl lght& all cdlptsi God answer all prayers tucked inside quickly special Intentions, put on V armor of God spclints fv, temporal & spiritual favors, love, special intentions, new ec car grt wnty grt gs mlg special intentions cmptr, love, prosperity, spclints, Special Intentions & Petitons, Pettions, Special Intentions, Special Intentions & Pts, V’s healthy happy peaceful wlpdiso pure chaste kind simple evdyisecure stablei calm loving proprs sii mild gntli Ctc dtg wlpdcri sac married home family prg motherhood children dtv mrg retmnt si life siiii fv, Special Intentions, Special Petitions, Special Intentions, Jesus mold V into who V is to be for God, graces V needs most, goodness, Special Intentions, spclints lglg aty fv mercesisii fv, dtvctnsi spptsi fv, real siicl moral value based ii friends family husband like ST Joseph md attnys agent publisher emplyrsii church community apt cmplx inlwi stii bkcyiii aptbldii ent associates siiii car md hi ci fvrs mercies sii fv, love, love, peace, sii cmm cpnsi krgrgsut fvi siifv, special intentions fv, love, si seisiiiifv, heal end the idle chatter of V mind fv, si, healings, happiness, joy, si, spclints, find Vs nitch, love spclintssiifv, love sptsspclints, mldns hp love spclints, sfiifv, peace & joy, calm, gnlns, love, peace of mind & body, Special Intentions, real isi moral value based sii friends family prof hlrs agent emplyr publisher community church apt car hi rtmnt ins careers bs hlth hlgs pry sts md attnys sti hrs ci inl chi mscln cutei chtci stable secure pure chaste faithful gentleman husband similar to St Jsphi fv mercies siiifv, Special Petitions, mindfulness, orgzgi sii fv, sppts, Special Intentions & Petitions, isltxntltrsidmiihdfslpmdhihpii fvi, love, si, stability security si peace, spclints, cloak V w/ the cloak of St Patrick’s breas*plate & SI, 20/20 vision, Special Intentions, happy unions, love i thanksgivings, reparation for sin, souls in purgy, curb V appetite and raise V metabolism fv, healings, help V eat 1000 calories per day burn 400 per day in exercises lose inches fat and lbs eat high protein high fiber high veggies and high fruit no refine sugar lactose free very little carbohydrates sppts fv, best daily routine for V sppts, fv, divine timing, IRS SL TX NTLTRS SI favors, love, provide for all of my needs just for today Lord and keep me from stain of sin just for today, love, ctrl tongue, spg/rtn fv, love, edkrggsutcarcmmdtgcciiut fv and gc si fv, special intentions, 10 commandments in our homes churches schools businesses government and USA sii fv, love, temporal and spiritual favors, love, peace, peace of mind, jsi, justicei, mercy, spclints and petitions, dsfrtgsintmf fv, love, special intentionsi, healing of the Catholic church and all of its members sii fv, special intentions, purity in USA and the Catholic church and its members fv, love, peace, spclints fv, ctrl tongue, faith hope clarity fv, gentleness, gifts and fruits of the Holy Spirit, mercy, joy, happiness, calm & peace in our homes USA & earth, shptrtnsinwfsiMary & St Josephs ints swap, love hope sii fv, V’s chidlrens books sttxntli fn si peace hope joy btr health & healings btr ptsn career dtg to take off fv, a new economy car great warranty and gas milage sii fv for V, love, jsi, mercies, siiifv, love, calm, mercy, sii, curb V apt rs V mtb help V lose inches lbs fat V eat high prtn high frbv frst frt frsvgt hihg vg no refn sugar very low carbs sisi fv, good luck sii , organze V apt dec V aptisiii vlplskipeace, jsi, siii, professional and personal favors, heal strengthen and make whole in body mind and soul V JJIi KQi DMDi SJIi RIi RTITMISFI TAi JCI CGI SIIii iiispgrtnexfv stgfv love sisifv, fvi, special intentions, control of tongue, sppts, contacts I need sii fv, sppts, krggsutfrtgc fv, sppts, love, safe travel for V JJi SJI and all in WV USA and on earth mercies and favors si, my car to pass inspection prty tx frtxi health insurance apt insiii hlw aaa z mfi fv mercies si, clarity, love, special intentions, love, car washes gc fv, oil change gc favors, car repairs gc favors, ed gc favors i, spclints, spclintsi, God bless V’s Spring Summer Fall Winter & holidays sp, carpoolingsii, spclints, fsii sppti fv, sppts, love, V godly si emplymnt siifv si, sei, keep V & SISIfree from all bodily mental legal demonic satanical financial health harm filled with the Prs Bld Jesus Christ 24.7.365, purity, chastity, peace, gtigskrgutclhmgciislcriispgrtexiiiifvi, siiiiifv, V’s entire recovery team siihfctxdtghlstjcliiiiifviii, faith hope and inspiration return of faith sii fv, sii atntdtgrtifrshfrtfrshvgt sl clrns slfclratiiinnocence, modestyii, positivityi, confidencei, spclints, si, bodily and spiritual healings for all in need of healing in WV and USA merciesi, special intentions, peace in my own familiy and all families in USA, love, spclints, overcome temptations, self control, sii, stability, security, calm, sppts, prosperity, deliverance, restoration, good news si, special intentions, pro life sii, sptns, love, joy, end the chatter of the mindi, si, calm, love, ppi, prosperity sii fv, spptsi, love, si, kindness, spclints, love, spclintsi, love, sppts, special intentions, special intentions, love, sell my silver car sii fv, si, si, cool crisp safe Godly kind modest healthy stable secure pure chaste Christian Catholic sii Spring Summer Fall in V community siiii fv, close door fast on what and who I don’t need in my own life or that’s just not the best for me and more good happy best for me people places ideas things income friends family career husband like St Joseph I need that is most pleasing to God in my own life be obvious to me sii fv, heal my memory fv, sppts, heal everyone’s memories in USA favors, healings, btr health btr pstn, sppts, best daily routine and divine timing for V siipp sptstemporal and spiritual favors, better health and healings, btpstn, love and calm, spclints, best daily routine for V sii fv, spclints, love, keep V free from all mental emotional dctfl stncl dmnc bodily acdntl lgl ih fncl career prof harm filled with the Precious Blood of Jesus Christ, si, financial blessings and favors, si Special Intentions, my beloved asleep in Jesus Christ relatives si souls mercies sii, stability, security, financial security and financial stability, peace, love, self control, spclints, my car and apartment God’s blessings and protection, spclints, spclints, love, divine timing and divine order, spclints and pts, desire of the two hearts, thank you’s, my own guardian angel STs Michael Gabriel Raphael all Cherubim Seraph Arch Powers Thrones Dominions all Holy Angels and Saints and Mary thank you for your intercessory prayers, Special Petitions, Special Intentions, Sprcial Intentions deiverance peace restoration, Special Intentions Special Intentions, love, calm, sp, love, calm, piety, sii fear of God knowledge goodness faithfulness gni si, virtues and graces I need most, love, spclints, spclints, love, spclints, peace, give V and SJ Godly relationships si fv, finances and income all needs and obligations met with ease and some left over fvrs sptsii fv, 20/20 vision back neck brn foot spnifn lg dt healings fv, love, hope, mercy, understanding, good counsel, wisdom, si, V’s childrens Christian books dating monies careers to be blessed by God and take off to good success, good success in every area of V’s life, contacts and people I need si fv, spclints, purity, chastity, spptsifv, legal financial temporal sprtl career car favors mercies, love, Special Intentions, Special Intentions, Special Intentions, si, childlike, make me a child of GOD SI, innocence for V SJ and all in USA mercies, peace, love, graces and fruits of the Holy Spirit fv, si, love, prudence, fortitude, knowledge, spclints, joy, God mold V into who V is to be for GOD, spclints, frtdscpt clphni fv, mercies, love, help me to eat healthy si fv, clarity, spclints, love, hope, calm, si, 20/20 vision, heal V back brn foot fn mnst sltx dtg car lgl bkcy siii lf si fv merciesi, love, si, clearing, grounding, gentleness, peace, Special inecial intentions & Petitions special intentions, heal the chatter of V mind sii fv mercies, love, special intentions, keep the worm away from V that eats up V’s monies finances health rgodly relationships money income crsi life sii fv mercies, love, special intentions, strengthn heal make whole in body mind and soul Victoria JJI KQ TA DM RT SII SJI and all in WV and USA siii fv mercies, temporal lg bk sltxntiihdfslpdmihphirptn awdrpiiiivpiifrtclpnsiaptntiatii hlg hpns stbt scrt peace of mind and body car cmm cpns ent dtg divine timing siiii fv mercies, faith, hope, peace of mind and body, love, hhbii, love, heal my DAD and SJ SP and V fv mercies sii, confidence, sell 7,000 books per year sii fv, spclintsi, special intentions special intentions, wisdom, holy fearsi, fear of the Lord, si, stability, security, peace, temperance, purity, modesty, sii, love, organize V apt dec V apt strg V apt sii fv, special intentions, love, spclints, love, help me to earn money and respect for and with my godgiven skills in a godly environment and supervisor sii fv mercies, special intentions, love, splints, love, find V nitch, graces V needs most God mold V into who V is to be for Christ, healings, joy, faith, hope,pregnancy motherhood vns car hi gentleman =ykd husband like ST Joseph sii fv mercies real for V siii mrlvlbs friends fmay agent emplyrsi state gv apt community church inlws md attys publisher ins spkrsbs cmtry hlrs profs bs cmntysi fmiiiii hsbd=ykd lk St Josphiifv mercies siifv, fix V car computer sii fv, sii fv, love, calm, tranquility, siiifv, paid monies and respect for my god given skills talents siifvk kcut cords not best for V help V form healthy holy attachments plsg to Jesus and best for V sii fv, love, peace on earth, joy, happiness, love, siifv, keep V free from all physical violent bodily mental demonic financial rpn crs dtg si ill health dctfl harm filled with the prs bld Jesusi fv, sii fv, love, sii, desire of the two hearts, love, peace, si love, si bless my apt car projects plans careers health income monies finanices rep iat all times fv mercy goodness love faith hope kindness gentleness peace si vllskiii, put mind of Christ on all in WV USA and on earth fv, sii help V de clutter organize siii new frntrs storage organizing si book shelves cabinet washer/dryer si computer internet TV clphn sii V retirment fv mercies sii, V’s happy healthy peaceful kind secure stable pp practical every day pure chaste moral value based real Catholic wlpdii Christian dating careers wlpd sacramental marriage home family love, si, purity chastity sifv, put mind of Christ on V JJI SJ SII all in V community WV & USA & on earth sii 24.7.365, Svtn for all USA & WW, sptsi, mildness, meekness, si, confidence, peace, spclintsifv, heal V memory and all peoples memories in WV USA and on earth favors siiii fv, conversions, one man one woman sacramental Catholic marriage in WV USA and on earth fv mercies, si, Special Intentions, spclintsii, special intentions & 72 degrees & peace in Vs cmty yrrnd burn out ending all Stns pomps & works evlspts neg evil ints hoG violence greed gossip meanspts ngi revenge skg false idols storms cancer adctns na snsofflsh mugging dstrctvns dstcn si vandelism pride impurity coveting envy jls stgsx&flptsi si evlintigdlsn na wlns dpi macho crs hxs pulling the rug out sii discords opprsg the poors anger actsw of fury wild wtchcrt abtn euthenasia lust roving eyesi disasters dope hmls in need poverty rrdg undrmg emotional abuse immaturity childishness pride impurity paganism false idols dense spirits of destructions darkness worldliness homelessness si secular prngy prstn allergies asthma toxins heart attacks strokes cancer lnlnsii flsprnflpnii negativity tepidnesssi wrath avarice malice greed obnicity in sinsi indifference ingratitude presumptionsi despairsi sodomysi insct to the wage earnersi spclints, si, greed, childishness, immaturityi, emotional abuse, si, dprsn, bp, sppts mri si fci effeminacy taking advantage of the poorsi lsei melancholy cold/flu sz si impurity dpn pranks ice/snow silightening I hvy & frzg rn black ice si drnks drkdrg tension si thieves of hope si meanness si insolence indifference ingratitude jzblsi ldgoni splints iii dns sifv, plsrdtg/plsrmrg mntlilns siii lsei anger bickering sof sabotage rrdg scdi I poverty secular wmbs macho na wldns stnsm one upping bltg si floods every storms sp paganism sins sbth splints personnapping spts spells bwtcmt si mean jokes flns frsi floodsi brkini fighting dmscabsi arguing bickering mugging vandalism ancestoral crs si grudge si ssa CthcPrsn mri fci collisions spclnts doai cold/flu al/asma gdlns poverty randy instability promiscuity promiscuous outfits ego eimisibiha demons nervous/mental/emotional disorders hatred of God wmbs special intentions muggings spclints pulling rug out accidents si bitterness flirting worldliness paganism pride impurity spcls ssa spclints adultery affairs emotional abuse immaturity childishness despair si tension competition rivalries oppressing the poorsi pranks suffering of the oppressedsi sins on the sabbath si wlvsi taking advantage of the poorsi si wanting to get someones secular scientificism unversalism si disasters I idestruction frsi brkn wldns na iiibearing false witness vain glory splt plyby/plygrl mntltyliving spp sins of the flesh carnality greed secular tension muscle tension worldliness godlessness si shootings stabbings si superiority complex no moral compassi gangs sppts ldgon leading astray si wmbs deadly sin poverty cptn prctni rlvrsii opprsg poors curses hexes ancestoral curses blindness eimisibipiha in need addictions hatred of God depression mrii grudges unequally yoked Catholic scmtl marriages mpcii abortion extreme heat high humidity violent storms flooding lightening thunder rnks blygsii pretentiousness arrogance ego si chlndsi imtrtys Catholic persecutions dementia collisions rape pmr abortion culture of death asistend suicide depression hyper anger rrdg undermining wanting to GET hurt somones opprsg the poors gossip swearing rnki relativism disasters storms ice/snow/allergies asthma si drugs violence guns/weapons despair flhpflsprncprncsi false idols envy jealousy sins of the flesh scantily clad women and men macho jzblsi ssa ssm relativisms leading astray ll si fci hexes curses ancestoral curses sii promiscuity one upping mean spireitedness prygi drunk driving pretentiousi murmmering mocking blygi Christian Catholic persecutionsi bp anxiety blygi macho si hmwrkrs secular lsei gltnyi sugar and carb addictions drunkenness hschnsi ha trblmkgi se*pots/fleshpots disasters destruction melancholy ax bp mri fci si rp drgs spw es crs hxs heresy si cmptn dprsn alcoholicism un4gvnsii pranks childishness revenge seeking greed si culture of death si mpcii familiarty btwn se*esii ax bp sii all various storms Red Dragon grudges unrepentance si coveting si ill will Anti Christ bewitchment spells false idols sins on the sabbath envy jealousy lust paesi sii, bslphmyi heresyi indifference carnality sins of the flesh insolence stabbings violence si curses gvg flststmyi covetting plsrskgi eimisibipiha si doai Catholic persecutionsii poverty indifference ingratitude si chpns sii ego siii in V community state of WV USA wwi V fmly frds SJIII for honor of Infant of Prague Holy Face of Jesus and Jesus King of all Nations Our Lady of Sorrows Immaculate Virgin Mary Our Father, etc Hail Mary, etc Glory be, etc. Sptcis​

Al aire libre
Pres Bld Jesus, Infant of Prague, Jesus Eucharistic Lord, Jesus Dvn Physician, Holy Spirit, all Guardian Seraph Cherubim & Arch Angels, & Holy Face Jesus JKAN, OLS OLGC OLGS OLGR OLMM OLMC OLF OLV, Sts Pio Anthony Expedite Ann Joseph Cthn Alxdra Jude Rita Paul Bosco Christopher MG TA Joan of Arc Dymphna Benedict Francis Assisi Lucy Scholastica Clare please adopt V as your spiritual child pray for V & all of V’s intentions; bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity peace love childrens books sltxntlrsirsi, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, reparation for V sins & sin,, peace on earth, special intentions & petitions, strengthen heal make whole in body mind & soul V JJi DJi RTi KQi DMDii TAi SJI & all in USAii, keep V free from all bodily mental emotional mental stncl dmnc dctfl financial brp careers dtg harm filled with the Prs Bld Jesus Christ, keep V free from all physical body mental emotional nervous financial lgl satanical demonic deceitful brp career si sp harm filled with the most precious blood of Jesus Christ, God bless in peace and charitysiii in Jesus Christs V’s apt home car all gvt churches V’s apt bldgii krg hlw banks financial institutions job emplyri sii lg emplyri gvt plcsints any public or private place V enters or name is mentioned with the Prs Bld Jesus Christ sii fv merciess i, strengthen heal make whole in body mind and soul V filled with the presbld Jesus Christ, strengthen and heal what is wrong in V and SJi and bring out the good si so they have a happy healthy godly pure chaste faithful peaceful sacramental dti sacramental marriage home and family life with each other and Jesus sii fv merciesi, sii, V and SJ car all vehicles they are in and all modes of their travel to be given safe travel mercies free from all accidental wrk clns fni demonic bodily mental sick physical stncl harm filled with the precious blood of Jesus Christ fv mercies, hope and inspiration, si, V and SI salvation and all of V’s and SJ ministries for GOD to be fullfilled filled with the precious blood of Jesus Christ fv mercies, good luck, purity, godly relationships in V and SJ life filled with the Precious Blood of Jesus Christ fv, God bless V’s income monies & finances all needs sii & obligations met w/ left over sii in abdc stability, security, special intentios, love, special intentions, thanksgivings, spclints, love, si, prosperity, calm, wisdom, understanding, clarity, level hdns, spclints, God bless Vs car fix Vs car affordably cmm gskrgrutgcii agent childrens books careers all V’s ministry’s fulfilled peace healings better ptsn better health love dating lgl bkcy sltxntlsi apt finances income dmihdfslphlwi dvn tmng dvn order sptcls edi hrmny get paid money & respect for my god given skills prkvlpstiii EMBSPH hlgs love si rtmt ent si tmprl lgli prsnl prof frt clphn cmptr fvrs mercies sii, 20/20 vision, healings, husband like ST Joseph for Victoria, love, mercy, peace, provide for my needs Lord just for today, keep me from stain of sin just for today, spclints, love spclints, conversions mercy, love, ctl of tng EMBSPH healings for V JJi SIii & all in WV & USA intss mercies, love, spclintsiiiiiiiiifv, gentleness, love, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, stability, security, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiijiiisi favors mercies, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp temps 67 with peace calm & no storms in V community year round mercies, peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride impurity storms greed coveting adultery lust taking advantage of the poors macho emotional abuse immodesty insolence indifference mugging gdlsn wkdns sii envy jlsy ingratitude arguing violence collisions cancer heart attacks strokes alhxs bwtcmt worldliness violence malice anger dspair wmbs sii wpns vandalism allergies bp ax sz confusion rrdg undermining opprsg the poors roving eye sins of the flesh negativity swearing false idols addictions Stns pomps & works evl spirits meanspiritedness emotional abuse ax emotional/nervous/mental disorders dementia heart disease, simortal sin si i chlsnsi imtrty hnpkgi si plotting evil ssa ssm pmr rp secular revenge seeking curses hmls in need poverty SII in V community, WV, & USA V SJIIVFMFIIImercies spits special intentions. ​
Precious Blood Jesus, All Angels, all Guardian & Arch Angels, & HFJ bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity peace love childrens books careers finances moniesi sltxntlrsirsi, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & all in WV & USA mercies, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, special intentions and petitionsi stability, security, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiiijiiisi favors mercies, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp temps 67 with low humidity peace calm & no storms in V community year round mercies, peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride sii fci ngtvty evil intentionsii greed malice anger violences mri Vlswi impurity storms greed chatter of the mind tension coveting adultery lust taking advantage of the poors macho emotional abuse immodesty insolence indifference mugging ingratitude arguing violence collisions cancer heart attacks strokes meanspiritedness revenge seeking curses homelessness in need poverty SIII in V community, WV, & USA VSIIIIIII mercies special intentions. ​
Al aire libre
Al aire libre
Precious Blood Jesus, All Angels, all Guardian & Arch Angels, OLS SHJ IHM JKAN Jesus Divine Physician Jesus Eucharistic Lord Sts Pio Anthony Ann Expedite Christopher Jude Dymphna Michael Gabriel Raphael Martha Rita Faustina & HFJ bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity peace love childrens books careers finances moniesi sltxntlrsirsi,hdfslpdmmowiifv mercies si,iisi, love, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & all in WV & USA mercies, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, V and SJ relief from all pain fv, special intentions and petitionsi stability, security, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiiijiiisi favors mercies, get my future gentlman husband like ST Joseph to ask me out siiiiifv, thank yous, love, joy, peace, calm, healings, happines, siii, love, love, siii, sisiiigodly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp temps 67 with low humditiy peace calm & no storms in V community year round mercies, peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride impurity storms greed chatter of the mind tension coveting adultery lust taking advantage of the poors macho emotional abuse immodesty insolence indifference mugging ingratitude arguing violence collisions cancer heart attacks strokes meanspiritedness revenge seeking curses homelessness in need poverty in V community, WV, & USA mercies special intentions. For honor of Infant of Prague and Holy Face of Jesus. Hail Mary, etc. Glory be, etc. spptis ​
Al aire libre
All Holy Guardian angels, Infant of Prague, Precious Blood of Jesus, St Pio, St. Anthony Padma, Holy Face of Jesus, Jesus Divine Physician, Our Lady of Good Counsel, Our Lady of Good Remedy, St. Anne, St Padre Pio, St. Anthony, St. Basil, St. Moore, St. Michael, St. Gabriel, St. Raphael, entire Celestial Court, St. Andrew, St. Lucy, St. Expedite, St. Joseph, St. Benedict, St Therese of Liseux, St. Catherine of Alexandria, St. Vincent de Paul, St. Isidore, St. Nicholas, St. Barbara, St. Martha, St. John the Baptist, John Good Disciple, St Germain Cousin, St. Christopher, Our Mother of Perpetual Help, Our Lady of Victory, St. Therese of Calcutta, Jesus Our Eucharistic Lord, and Our Lady of Sorrows, please pray for all the petitions below even when our humanness is weary and cannot finish. Bless protect provide guide heal prioritize help improve and answer the prayers ASAP for all of our petitions below granting all clarity, peace, clear headedness, hope, faith, and joy. Glory be to the Father Son and Holy Spirit as it was in the beginning is now and ever shall be World without end. Amen. Thank you. ​
Al aire libre
UPDATE: We were asked to pray for the Precious Blood of Jesus Christ, Jesus Divine Physician, Infant of Prague, Our Lady of Sorrows, Our Lady of Gudalupe, Our Mother of Perpetual Help, Our Mother of Good Remedy, All Arch Angels and Guardian Angels, all Holy People in Heaven and on Earth, Holy Face of Jesus Christ, Jesus King of all Nations, SHJ, IHM, Jesus Our Eucharistic Lord Sts Dymphna, Expedite Padre Pio Anthony Ann Catherine of Alexandria Jude Joseph Basil Moore Faustina, Isidore Bernard of Clarvoix, Therese of Lisuex please adopt as your spiritual child; Bless protect guide provide help to improve in abundance si 2 single Catholics and the follow petitions for both of them: legal blessings & favors finances and needs and spiritual and physical healings and strengthening, Jack, Warren, and Lisa fighting cancer, healing of 15 fighting dark spirits of alcoholism defilement pride modern paganism immaturity worldliness mean spiritedness bewitchment emotional immaturity curses and hexes childishness and revenge seeking sp pets; grant peace, healing of 6 overcoming physical and spiritual sickness, home furnishings for one and rent/utility/car/travel/employment/self-control/love/mercy/healthy food/money/temporal and spiritual favors/better health/business success/Clarity/Financial Restitution/Memory/clear thinking/put on the mind of Christ at the top of every hour 24/7 all year long/spiritual mental emotional and physical healings and strengthening/better position/taxes/legal needs and blessings/professional and personal needs/happiness/safe travel/peace of mind/divine timing/good luck/good fortune/strengthening and make whole all body-mind-soul/clarity/moral godly stable mature secure real supportive in every way friends family spouse professionals church employer best for this persons personality and needs, Mary and St Joseph’s intentions swap, 7 to overcome spiritual dangers and overcome temptations and 1 to overcome temporal dangers and overcome all temptations with 86 special petitions and intentions plus self control. Our Father, Hail Mary, Glory be, etc. Amen. Lisa is Sr. Mary Bowman’s niece. ​
Al aire libre
Our Lady of Lourdes and Our Lady of Good Counsel, I need an emotionally stable mature secure real Holy agent, attorney, publisher, equally yoked masculine gentleman husband similar to St Joseph friends and family church best for my own paid careers personality means and needs, healing of my back, healing of my neck, prioritize my own life, more ‘good’ I need that pleases God and close the door on what and who I don’t need that doesn’t please God helping me to keep it shut without overwhelming me and great paying Holy career with complete follow thru ASAP. Please rush these petitions and thank you. Please continue to help my writing to improve and finances, bringing me the best contacts I need to succeed for the greater glory of God, to support myself with ease, good health and abundance both financially and spiritually, and one day to be able to easily adopt children. To be a good healthy loving mother and provider in both body and soul to my future children. Please help me to ‘find my own nitch.’ Please guide bless protect shield and provide in abundance for these goals of mine for the greater glory of God. Make sure I have a great Holy understanding kind publisher, agent, and eventually secure gentleman husband masculine and Holy similar to St Joseph so I am able to spend time with my family. Please heal my back, keeping it strong and healed. Please make me whole and strong in body mind and soul filled with the precious blood of Jesus Christ, putting upon me the mind of Christ with a special petition. Please grant me 20/20 vision. Please bless protect provide guide heal prioritize help improve in abundance me and all my temporal and spiritual pursuits/favors career dating home car safe travel legal better health financial favors along with 52 special petitions. I would like help with affordable furnishing and decorating my own apartment home and fit bit that works too. Please fix my telephone so it receives the minutes. Please bless my car, safe travel, and fix my car and computer. Some of the sensors are still on, strengthen it. Please help me to organize storage decorate my apartment practically and life with a washer/dryer 3 book cases storage containers 4 clip pant/skirt hangers storage for my pink bike si furnituresi end tables 2 teach me sii with a tub and shower combo nice very quiet neighbors I jewelry organizers I curling iron organizers prtziirug sii 1 bed room apt or simple clean healthy affordable 2 bedroom if I can keep up the costs sii teach mei shoe hanger for doors affordable lamps all on sale clean practical sii ii fv merciesspecial intention. Please bless my shopping and returns, business success and favors, Easter Season, 4th of July, Spring and Summer, Lent, Labor day, Fall, Winter, New Years, Holy Days, Halloween, Thanksgiving, Advent, Christmas Holiday Season, Birthday, St. Valentines Day, Mary and St Joseph’s intentions swap, everyday with more good I need in life, less I don’t. Please make my own Holy Mr. Right ask me out to cherish me in Holy Matrimony giving him the graces he needs the very most removing from his own life what is not pleasing to God or that he doesn’t need with a special petition. Someone I honestly want to modest Catholic-Christian practical-modest-simple date leading 100% into a simple healthy Sacramental Marriage and eventually modest simple healthy family life. To have a classy simple modest life and conversation, where we say the rosary and take walks every night as a couple. Where we read the Bible and pray together, he blesses me daily too. Like a Holy adult who does cleave to me and God, not everyone else or everything else. God be with me and bless me. Thank you so much. Most Respectfully, Miss Victoria Jeskey​
Al aire libre
‘Humble yourselves to ask for God’s Help.’ ‘Be Merciful, Be Kind, Be Just, Listen to God’s Voice.’ Psalm 143:8 In summary: Remind God of your Love for Him every morning; Give God Praise. We received this in Charismatic prayer group. It’s true, we have so much to be thankful for in the USA. We need to remind Jesus Christ of our blessings God bestowed upon us. To give God praise and glory. All our love and thanks. ​
Al aire libre
Our Lady of Mt. Carmel, St Pio, St Anthony, Jesus Divine Physician, Jesus King of all Nations, St Ann, ST. Expedite, St. Basil, St. Michael, AA, GA, SHJ, IHM, Infant of Prague, Precious Blood of Jesus Christ, Holy Face of Jesus, Our Lady of Lourdes, Our Lady of Good Remedy, Our Lady of Good Council, Our Lady of Sorrows, Our Lady Queen of Peace and of the Angels, Sts Dymphna, Ann, Expedite, Basil, Padre Pio, Anthony of Padma, Joseph, All AA and GA, St Merton, Boscoe, Catherine of Alexandria, St Nicholas, St Isidore, St Barbara, St Martha, St John Baptist, St Isidore: please bless and answer the following Special Intentions & Petitions; healing blessing provisions and guidance i of Richard T., John J. Sr., John J. Jr., Victoria J., Katline, Thomas M. and staff, Thomas A., James B. and Sec, Don C., DaveMDi,VAJ, James C., Brad G., Chip K., Anita S., F.H., Bill D., Gabriel M., Dana J., Gabrielle J., Robin M., George & Michael, Dave MD, Sarai, Mchl Mi, Jnfr Frng of, Ntl Trs, Brad S. Manny, Ntl triDoug B. and wife, Ryan F., Sandra, Erin K., MWch, Brad G., V, Tom W., Michael D., Phillip, Sara F and staff, VJi, Hwd P., Prf Ag AtMdi,Kevin Quirk, Shawn Quirk, Cst Prf Dave MD si JJsr JJ jr si all my enemies si Mrtna, VJ, agt, FHLSJ, DrJ, Thms Mc && ofc stf’s, PK, B & FM’s,JJ sr JJ jr VAJ, RT FIF, DSIIICPITMMII, CBIPGLTBAFKII,, I IJ, GJI Michele M, VJ, VLJ, RT, Miss Jeskey, SI, V, GJ, TA and fm, TAP, Ntl Trsy, Ths prnts, SI SP&I spis ,all in need of healing, blessing, healing emotionally, healing physically, healing mentally, healing spiritually, put the mind of Jesus Christ on all of the above and every human being and animal every minute 24/7 all thru 2025 providing, and strengthening and making whole in body mind and soul psychologically physically emotionally physically back, allergies, asthma, hayfever, lonliness, rejection, abandonment, legal, soul from modern paganism, pride, worldliness, mean-spiritedness, revenge seeking, rage, jealousy, fear of failure, remove all curses hexes and incantations sending all to the nearest Catholic church to the Eucharist where they may be disposed of properly by God, remove planks from our eyes, give 20/20 vision, jealousy, emotional immaturity, oppression of the poor, suffering of the oppressed, lack of adaquet Holy reasonable housing finances and healthy food, childishness, emotional manipulation, violence, greed, hatred of God, pranks, practical jokes, injustice to the wage earners, removal of all wildness and encouragement of wildness and impurity/prides in USA and throughout the world special petitions. Grant V and I courage and perseverance si&p for love honor and glory of Infant of Prague and Holy Face of Jesus Christ. Glory be, etcs. Amen. Several Special Petitions and Intentions.​
Al aire libre
Entire Celestial Court, Bless us to increase the Kingdom of Light. End the Kingdom of Lucifer’s Darkness. Amen.​
Al aire libre
Let’s keep working. Keep sending us Holy work for God. Our Lady Undoer of Knots, undo the subliminal ‘knots’ in our lives. We surrender it all to Jesus, Our Eucharistic Lord and the Most Precious Blood of Jesus Christ. glory be, etc. Amen. ​
Al aire libre
Thank you for all blessings in our lives, and all blessings God via Holy Angels & Saints are preparing for us. Holy Spirit and Most Precious Blood of Jesus Christ, keep blessing, protecting, guiding, and anointing each one of us with the Precious Blood of Jesus Christ all of our hearts, eyes, minds, feet, ears, and hands to the blessings God desires for us.​
Al aire libre
Update: EXTENDED!!! We received a prayer request. Our Lady of Lourdes, Our Lady of Sorrows, Our Lady of Good Remedy, St. Expedite, St. NicholasHoly Face of Jesus, Precious Blood of Jesus Infant of Prague, Sacred Heart of Jesus, Immaculate Heart of Mary, St. Padre Pio, St. Anthony, St. Basil, St. Vincent De Paul, St. Isidore, St. Ann bless protect provide guide help improve in abundance best for one single Catholic lady all of her health tax FS Liep Dsb HUD health insurance and car insurance income bky tx and rcrt paperwork sp pet with God’s blessings and favors in all temporal, spiritual, Mary and St Joseph’s intentions swap, legal, moral value based cl secure relationship needs & contacts best for her in every area of her life. Special Petitions and Intentions. Glory be to the Father Son and Holy Spirit as it was in the beginning is now and ever shall be world without end. Amen.​
Al aire libre
God Bless America!​
Al aire libre
May the Most Holy Face of Jesus Christ be praised, loved, adored, and glorified in all of the Eucharistic Adoration chapels around the Globe. Amen.​
Al aire libre
HOLY Ghost, Enkindle in the Hearts of Your Faithful the Fire of God’s Most Perfect Charity. Amen. Help us Holy Ghost to do our part too. Amen.​
Al aire libre
UPDATE: Please continue to pray for one for a a ‘legal blessing,’ ‘Peace of Mind’ and ‘God’s Favor’ with a ‘special petitions’ via St Basil, St. Michael, ST. Anthony, St. Pio, Our Lady of Sorrows, Infant of Prague, Holy Face of Jesus, and Precious Blood of Jesus Christ as we plead for the celestial court to bless protect provide guide in abundance business success btr pstn for healing of Victoria’s back, wl, cn; the legal blessing and special petition. For the love, honor, and glory of the Holy Face of Jesus, Infant of Prague, and Jesus, King of all Nations. Amen. ​
Al aire libre
Al aire libre
Al aire libre
1. (a) We have five more persons who find it difficult to believe God wants them healed. That’s malarkey . We will pray for Our Lady of Lourdes, Precious Blood of Jesus Christ, Holy Face of Jesus, Our Lady of Sorrows, Infant of Prague, Jesus Divine Physician, St Pio, St. Anne, St. Anthony, all Arch Angels, All Guardian Angels, St Joseph, Our Lady of Mt. Carmel, St Nicholas, St. Barbara, St Maria Goretti, St. John Baptist, St. Lucy St Teresea of Calcutta to adopt them as your spiritual children bless protect provide guide them in abundance with healing from loss, unemployment, healing from childishness and immaturity, healing from depression and impurity, healing from moral relativism, divorce, anxiety, gossip, death of a loved one, healing from false idols, with a happy healthy future Catholic sacramental marriage, happily fulfilling God’s Ministry for them, peace, graces/virtues they need the very most, end to all ‘wildness’ and insecurity, end to fear of failure and rejection but grounded in Jesus Christ Biblical Law, security, stability, maturity, clearing-cleansing-and uplifiting putting on the mind of Christ every hour, Special Intentions, Special Petitions, Special Intrntions, Special Petitions, Special Intentions, Intentions, Special Intentions, Special Petitions, replacement with even better of all lost stolen destroyed or manipulateds, great health, clarity, faith, hope, clear-headedness, peace of mind, and charity. Make all whole in body-mind-and soul plus a Holy and Godly employer best suited for their needs/personality and God-given skills of Jesus’ choosing with great godly supportive Godly friends, family, professionals and husband/wife ASAP on the wings of the most Luminous Holy Angels. With 59 ‘special petitions Special Intentions Special Petitions Mary and St Joseph Intentions swap and Victoria’s wrtn ptns and daily offering prayer packet sppets.’ May the Precious Blood of Jesus Christ anoint, bless, and heal all who are in need of all healings in our own lives, families, friends, relationships, community, state, USA and World for the greater glory of Jesus Christ and His Kingdom. Amen. Glory be, etc For the honor glory and love of the Infant of Prague and Holy Face of Jesus Christ. Amen.​
Al aire libre
Horse feathers, Jesus doesn’t want them happily married in a Holy Christian-Catholic marriage blessed with saintly children. That is the devil talking that God doesn’t. Plus happy Holy employment/employers best for all their needs without being greedy. May God bless them during this time of healing, moving only forward with God’s Grace. It’s not Jesus who wants someone to be miserable their entire lives, that’s poppycock. Jesus loves us 🙂 Jesus heals. We LOVE YOU Too GOD.​
Al aire libre
Al aire libre
Al aire libre
Through the intercessory prayers of The Precious Blood of Jesus Christ, Holy Face of Jesus Christ, Infant of Prague, Our Lady of Sorrows, Sts Pio, Anthony, Joseph, Anne, Therese of Lisuex, Guardian Angels, and entire Celestial Court. Thank you for all blessings and answered prayers in our lives. Plus blessings yet to come which Jesus is preparing each one of us, for His Heavenly Glory. Open our hearts, hands, and eyes to be able to receive these blessings from God. Glory be, etc. For the Love, Honor, and Glory of the Infant of Prague and Holy Face of Jesus Christ. Amen.​
Al aire libre
Al aire libre
Al aire libre
Al aire libre
1.( b) Precious Blood of Jesus, Infant of Prague, Holy Face of Jesus, Our Lady of Sorrows, All Guardian Angels and Arch Angels, Our Lady of Mt. Carmel, St Anthony, St Pio, St. Ann, St Catherine of Alexandria, St Bernard of Clarivox, Jesus Divine Physician, Our Mother of Perpetual Help, Our Lady of Good Remedy, Our Lady of Lourdes, St. Expedite, St. Teresea of Calcutta, Jesus King of all Nations St. Joseph please adopt these 4 persons as your spiritual children. Bless protect provide guide in abundance best for three persons mercy, clarity, peace, joy, clear headedness, legal needs, professional and personal needs, stability, security, end to all wildness, end to all impurity, end to all pride, courage, perseverance, special petitions, Godly skills, Holy employer, Godly Holy respectable employment, health, utilities, human dignity, fulfilling joyfully God’s Ministry for them, soul, health insurance, courage, finances-all needs met with ease and abundance, home, Mary and St Josephs intentions swap, poverty of spirit, humility, car all vehicles, overcome obstacles, overcome temptations, human dignity, healthy food, graces needed the very most, emotional healing, physical healing, financial healing, mental healing, spiritual healing, purity of tongue, travel-all modes, put on the mind of Christ, remove all curses and hexes, healing of back-concussion, whiplash (teaching how to keep it healed and strong) gentleness, moral value based Godly (principles) real supportive spouse family friends professionals church best suited for these individuals personality and needs. With ease. Special Petitions. Glory be, etc. For the honor and glory of the Holy Face of Jesus Christ, Jesus Christ King of all Nations and Infant of Prague. May Jesus cherish them during this time of transition and learning. Amen.​
Al aire libre
Another added to pray for to Jesus Christ. :)​
Al aire libre
2. Precious Blood of Jesus Christ, Our Lady of Lourdes, Jesus, Our Lady of Mt. Carmel, Our Mother of Perpetual help, Divine Physician, Infant of Prague, Our Lady of Sorrows, Jesus King of all Nations, Our Lady of Good Remedy, St. Anne, St. Pio, ST. Anthony, St. Joseph, St. Expedite, ST. Basil Please adopt 4 in the following as your spiritual children. Bless protect provide guide heal in abundance best for their needs and in answer to their petitions: 3 persons and 1 kitty cats with ‘Special Petitions’ Glory Be, etc. For the Honor and Glory of the Holy Face of Jesus and Infant of Prague. Amen. Thank you.​
Al aire libre
3. Precious Blood of Jesus Christ, Infant of Prague, Holy Face of Jesus, Jesus Divine Physician, Jesus King of all Nations, Our Lady of Mt. Carmel, Our Lady of Sorrows, Our Lady of Lourdes, All Arch Angels and Guardian Angels, Sts Pio, Expedite, Gerard, Joseph, Basil, Ann, Teresa of Calcutta, and Anthony please adopt the 6 families, 3estranged Catholic couple, 5 individuals, and 8 businesses as your spiritual children Bless protect provide guide and help them to improve in abundance in all of their temporal, emotional, and spiritual needs, healing, strengthening of body-mind-and soul, health, Godly relationships, healing from emotional and verbal abuse, healing from neglect, healing from violence, healing from loss, healing from destructive patterns, healing of anxiety-loss-rejection-fear of failure, healing from moral relativism, psychological healing, healing from being used as chattel and end it, end to all pride, end to all bitterness, end to all parroting and bullying, end to all belittling, end to al harassment, sp pets, taxes, bkcy, healing from lonliness, chastity, purity of tongue, professional and personal needs, physical healing, emotional healing, financial healing, mental healing, spiritual healing, spiritual courage, end to all wildness & it’s encouragement in their lives, courage, perseverance, faith, hope, charity, generosity, travel-all modes of travel, legal, home, utilities, stability, security, car, business, soul, joy, clarity, humility, clear-headedness, gentleness, joyfully fulfilling God’s Ministry for them, desire for Holiness, gentleness, human dignity with Jesus Christ, healing and ending of familiarity between the sexes, purity of tongue, chastity, Godly Christian employment, finances, peace, virtues they need the very most and many special petitions and intentions. Filled with the Precious Blood of Jesus Christ. Glory be, etc. For the love, honor and Glory of the Holy Face of Jesus and Infant of Prague. Amen.​
Al aire libre
Thank you Jesus Christ for many reaching up to God asking for prayer, not to the ‘world.’ We praise you Lord Jesus Christ.​
Al aire libre
4. Precious Blood of Jesus Christ, St. Pio, St. Anthony, St. Expedite, Holy Face of Jesus, Infant of Prague, Jesus King of all Nations, Jesus Divine Physican, Our Lady of Mt. Carmel, Our Lady Undoer of Knots, and Our Lady of Sorrows adopt all of the USA as your spiritual children. Please end all poverty, ‘in need’ poverty, oppression of the poor, suffering of the oppressed, gossip, sacrilege, homelessness, hunger, false idols, coveting, greed, lust, gluttony, childishness, insolence, indifference, violence, end abortion, wildness, na, hatred of God, pride, impurity, worldliness, emotional abuse, and modern paganism in our lives, families, friends, government, neighborhoods communities Wheeling, WV USA, and World and hearts of all mankind giving all of us more peace, desire for Holiness, human dignity with Jesus Christ, gentleness, purity of tongue, humility, poverty of spirit, chastity, Pro-Life morals and values, forgiveness, put on the mind of Jesus Christ, financial healings, emotional healings, mental healings, physical healings, spiritual healings, bear wrongs patiently, love of God and Love of Neighbor. Help us all to joyfully fulfill God’s ministry and be gently obvious to each one of us closing the door to what we don’t need or is unpleasing to Jesus Christ in our own lives, giving us more ‘good from God’ that we need that is most pleasing to God in our own lives. Strengthen us to do our part too. Special Petitions. Glory be, etc. For the Honor and Glory of the Holy Face of Jesus, Infant of Prague, Sacred Heart of Jesus and Immaculate Heart of Mary. Amen.​
Al aire libre
5. Please ask Jesus to bless heal and fix my computer, internet, all utilitiesi, telephone minutes lc, car, and all of my computer needs for me. Thank you. One improvement was we upgraded my computer. That is an answer to our prayers, thank you. Praise be to God every step of the way. :)​
Thank you also for all of your prayers for my move and transition. I am still transitioning, as their is so much to learn and do. Jesus is having me take my time in learning these things too, as that’s okay with God. Praise Jesus Christ and all of Heaven’s Holy Army of Saints and Angels for my new sweet little home 🙂 Jesus bless, protect, provide and replace all that I need plus all that are involved too. Glory be, etc. Amen.​
Al aire libre
6. Precious Blood of Jesus Christ, Holy Face of Jesus, Jesus Divine Physician, Our Lady of Sorrows, Our Lady of Mt. Carmel, Our Lady of Lourdes, All Arch Angels, All Guardian Angels, Jesus King of all Nations Infant of Prague, St. Anne, St. Expedite, St Pio, St. Catherine of Alexandria, St. Jude, St. Joseph, St. Anthony, St. Theresa of Calcutta: please adopt the 2 individuals as your spiritual children who asked us to pray for them. Bless protect provide guide them in abundance helping them improve in all their temporal, spiritual, Holiness of Christian – Catholic dating-married and family life, healing, holiness, love-spiritual courage, money, human dignity with Jesus Christ, gentleness, peace, mercy, joy, heal hearts, thanksgiving, clarity, peace, faith, joy, stability, happiness, security, clear headedness, home blessing, car blessing, reparation for sin, forgiveness, chastity, employment blessing, bkcy blessing, tax blessing, real Godly moral value based cl supportive friends family husband similar to St Joseph atty professionals employer church best for their needs health and personality, legal favors, special intentions, Love of the Eucharist, put on the mind of Christ, Mary and ST Joseph’s intentions swap, Love of God and the rosary, purity of heart and hands, anointing with the Holy Spirit, car pooling, safe travel- all modes throughout the year, overcome temptations,Special Intentions, Special Petitions, special intentions & petitions, SI, put the mind of Christ, physical healings, mental healings, emotional healings, spiritual healings, overcome obstacles, end all bullying and childishness, peace of mind, business and career success, purity of tongue, financial blessings and favors, divine timing, divine order, better health, bkcy fvrs, tax fvrs, temporal and spiritual favors, purity, conversion needs and give them all of the virtues they need the most in each stage of life along with their cl moral value based best for their needs and personality family members professionals & friends to assist them with 8 special petitions. Glory be, etc For the Honor Love and Glory of the Infant of Prague, Sacred Heart of Jesus, Immaculate Heart of Mary, Our Lady of Sorrows, and Holy Face of Jesus Christ. Amen.​
Al aire libre
7. Precious Blood of Jesus Christ, Our Lady of Sorrows, Our Lady of Mt. Carmel, Holy Face of Jesus Christ, Jesus King of all Nations, St Expedite, St Padre Pio, St Anthony, St. Ann, ST. Joseph, Our Lady of Lourdes, Our Lady of Good Remedy bless protect provide guide in abundance all of the petitions in the Eucharistic Adoration chapels around the world and Holy Souls in Purgatory. Especially the ghosts of our family members. Grant us peace and God’s joy. Special petitions. Glory be, etc. For the Love Honor and Glory of the Infant of Prague and Holy Face of Jesus Christ. Amen.​
Al aire libre
8. Precious Blood of Jesus Christ, Our Lady of Sorrows, Infant of Prague, Our Lady of Mt. Carmel, Holy Face of Jesus Christ, Our Lady of Lourdes, All Guardian Angels and Arch Angels, St Ann, St. Pio, St Anthony of Paduma, St. Catherine of Alexandria, St Therese of Lisuex, St Theresa of Calcutta bless protect provide guide in abundance myself, Victoria, with an equally yoked mature secure stable gentleman masculine happy loving Holy husband similar to St Joseph. Giving us all of the virtues, peace, peace of mind, stability, security, purity, chastity, maturity, and graces we need most in life Mary and St Joseph’s intentions swap. Glory be, etc For the honor and glory of the Infant of Prague and Holy Face of Jesus Christ. Amen.​
Al aire libre
9. Precious Blood of Jesus Christ, Our Lady of Sorrows, Our Lady of Mt. Carmel, Holy Face of Jesus, Jesus King of all Nations, Infant of Prague, St Anthony, St. Anne, St. Pio please adopt my apartment complex and all residents as your spiritual children. Bless protect provide guide in abundance all residents and WODA corporation in all temporal, spiritual needs, graces and virtues needed the very most, clarity, clear-headedness, purity, and peace along with a special petition. Glory be, etc. For the Greater Glory and Honor of the Infant of Prague and Holy Face of Jesus Christ. Amen.​
Al aire libre
10. Precious Blood of Jesus Christ, Our Lady of Sorrows, Holy Face of Jesus, Our Lady of Lourdes, Infant of Prague, St. Joseph, Jesus Divine Physican, St. Basil, St. Merton, St. Ann, St. Theresa of Calcutta, St Padre Pio, all Guardian Angels, Cherubim, Arch Angels, and St. Anthony bless protect provide guide in abundance best for the two persons who asked us to pray peace, Mary and St Joseph’s intentions swap, legal, finances, dating, clarity, healing and healing from emotional abuse, ‘clear-headedness’ clarity, all vehicles, Holy Boldness, Joy, and Holy career needs. Glory Be, etc. For the Greater Honor and Glory of the Holy Face of Jesus Christ, Jesus Christ King of all Nations, and Infant of Prague. Amen.​
Al aire libre
11. Precious Blood of Jesus Christ, Holy Face of Jesus, Our Lady of Sorrows, Infant of Prague, Jesus King of all Nations, Our Lady of Mt. Carmel, Our Lady of Lourdes, St. Anthony, and St Pio please adopt the disabled, 4 individuals who asked us to pray, ‘in-need’ and poor in our community, state of WV, and USA as your spiritual children providing in abundance for all spiritual and temporal needs. Bless protect provide guide in abundance for all healing of weakness, healing from moral relativism, strengthening of the good that is ‘of God’ making all whole in body mind and soul. Bless with Godly supportive real spouses, family, friends, professionals, health care team, and church best suited for all’s needs, peace, clarity, clear-headedness, Mary’s intentions swap, human dignity, gentleness, peace in the family, finances, joy, Faith, Hope, purity of tongue, chastity, stability, security, home, car, travel, holy boldness, healthy food, holiness, forgiveness, respect, Godly career and employers, and graces needed the very most for each individual. Special Petitions. For the honor and glory of the Holy Face of Jesus, Infant of Prague, and Jesus King of all Nations. Glory be, etc.​
Al aire libre
12. St. Pio, Holy Face of Jesus, Jesus King of all Nations, Our Lady of Sorrows, Our Lady Undoer of Knots, Our Lady of Lourdes, Jesus, Divine Physician, Our Lady of Mt. Carmel, Precious Blood of Jesus Christ, SHJ, IHM, all Arch Angels, all Guardian Angels St. Theresa of Calcutta: for the conversion of sinners, end to violence, end to all dark dense spirits of pride, end to all impurity, end to false idols and coveting, end to emotional abuse, end to all dark spirits of childishness and immaturity, end to all moral relativism and healing from it, healing of ‘macho’ healing of argumentativeness and hate, healing of willful murder of Holy Spirit and body, healing of subliminal knots, end of and healing of oppression of the poor and suffering of the oppressed, healing of violence with gentleness and peace entering into all man-kinds hearts, healing of wickedness, healing of disrespect of human life and dignity of human person, Mary and St Joseph’s intentions swap, for the souls in purgatory for several with 3 ‘special petitions’ Grant all living in our community, state of WV, USA and World peace, clear-headedness, put on the mind of Christ, clarity ,human dignity with Jesus Christ, holy boldness, special Intentions, Special Petitions, Special Intentions, purity to tongue, chastity, emotional maturity security and stability, peace of mind, gentleness, perseverance, forgiveness, Faith, Hope, Charity, love of God, love of neighbor and poverty of spirit. With a special petition. Strengthen all of us to do our parts too. For the love, honor, and glory of the Holy Face of Jesus, Infant of Prague, and Jesus King of all Nations. Glory be, etc. Amen.​
Al aire libre
13. Precious Blood of Jesus Christ, Our Lady of Lourdes, Our Lady of Sorrows, Holy Face of Jesus, Jesus King of all Nations, Infant of Prague, Jesus, Divine Physician, SHJ, IHM, Our Lady of Mt. Carmel, St. Anthony, St Expedite, St. Basil, St. Michael, St. Joseph, St Padre Pio, ST. Ann, St. Jude, St Augustine, St Monica, St. Boscoe, St. Dymphna, St Catherine of Alexandria, St Isidore, St Gabriel, St. Raphael, St. Benedict, and St Pio please bless protect provide guide help improve answer the prayers, and provide healing ASAP from the Divine Physician Jesus Christ in abundance 11 ‘special petitions.’ For the love, honor, and glory of the Holy Face of Jesus, Jesus King of all Nations, Our Lady of Sorrows, Sacred Heart of Jesus, Immaculate Heart of Mary, and Infant of Prague. Glory be, etc. Amen.​
Al aire libre
14. Precious Blood of Jesus Christ, Our Lady of Sorrows, All guardian angels, Holy Face of Jesus, Infant of Prague, Our Lady of Lourdes, Jesus King of all Nations, Jesus Divine Physician, Our Lady of Mt. Carmel, St. Pio, St. Expedite, St. Ann, St. Jude, St. Terese of Lisuex, Jesus Divine Healer, St. Blaise, St. Benedict, St. Merton, St. Basil, St. Bernard of Clarvoix, St. Monica, St. John Boscoe, St. Thms Aquinas, St. Rita, St. Augustin, St. Vincent de Paul, St. Joseph, St. Anthony please adopt the 2 estranged Catholic couples, 1 individual, 9 families & 2 couples who asked us to pray. Bless protect provide guide heal help improvie in abundance emotional healings, physical healings, spiritual healings, financial healings, mental healings, put on the mind of Christ every minute of the day all thru the year, an end to all dense & dark spirits of emotional abuse, competitiveness, pride, jealousy, sins on the Sabboth, lust, greed, adultry, gluttony, fault finding, covetting, envy, false idols, bearing false witness, modern paganism, argumentitvness, bitterness, childishness, suffering of the oppressed, oppression of the poor, cursing, hexing, in need, volatile behavior, poverty, violence, ‘in need’ murmering, wrath, healing from moral relativism and ending it in their lives, jealousy, sloth, mean-spiritness, imbibing, careless driving, revenge-seeking, spiritual sloth, fault finding, gossip, criticizing, obnicity of sin, presumption, lust, willful murder of body and soul, praising advising encouraging, hinderance of sin, immodesty, bickering, worldliness, curses and hexes, fault-finding, greed, stinginess, impurity, lust, immaturity also providing healing, Faith, special Intentions, Special Petitions, special intentions, special intentions & petitions, SI, Special Intentions, Special Petitions, Hope, mature secure stable relationship with Jesus Christ, Charity, clarity, gentleness, stability, security, clear-headedness, holiness, peace, purity of tongue, chastity, holy boldness, mercy, human dignity, forgiveness, patience, gentleness, generosity, overcome temptations, peace in the family, put on the mind of Christ, emotional maturity, self-control, better health, secure stable constant financial income, safe travel all modes of travel keeping them free from all accidents violence and financial/legal ruin, employment with Holy Employer best for their needs and personality, and blessings special intentions. Grant them the Godly financial answers they seek with only Godly people best for their personality, soul, and needs. Filled and protected with the Precious Blood of Jesus Christ. Also the special petitions asked of us to present to God. May this blessing extend to all in our community, state, USA, and World. Help all of us to do our part too. For the honor, glory, and love of Holy Face of Jesus, Infant of Prague, St. Ann, Our Lady of Sorrows, and Jesus King of all Nations honor and glory. Glory be, ect. Amen.​
Al aire libre
15. Precious Blood of Jesus Christ, Our Lady of Sorrows, Our Lady of Lourdes, Immaculate Heart of Mary, Our Lady of Mt. Carmel, Holy Face of Jesus Christ Sts Pio, Ann, Anthony, and Expedite please adopt the 9 girls/adult women headed for trouble along with 5 men, (both spiritually and temporally/physically) and ‘special petitions’ as your spiritual children who we were asked to pray for providing for all of their holiness, temporal, Holy professional spiritual career of God’s choosing, health, healing, healing from moral relativism ending it, church, clear-thinking, soul, clarity, conversion, clear-headedness, joy, peace, human dignity with Jesus Christ, gentleness, Faith, Hope, Charity, virtues, chastity, purity of tongue, peace in the family, finances, peace of mind, home, car, poverty of spirit, Godly real supportive friends and family needs best for their individual needs with a ‘special petition’ being VERY Obvious to all. May this cleansing and blessing extend to all of our families, community, state of WV, and USA. Amen. Glory be, etc. For the love, honor, and glory of the Holy Face of Jesus Christ, Infant of Prague, Jesus King of all Nations. Amen.​
Al aire libre
16. Precious Blood of Jesus Christ, Infant of Prague, Our Lady of Sorrows, Holy Face of Jesus, Our Lady of Lourdes, Our Lady of Mt. Carmel, Our Lady of Good Remedy, Our Lady of Gudalupe, Jesus, King of all Nations, Jesus Divine Physician, all Arch Angels and Guardian Angels, SHJ and IHM Saints Basil, Dymphna, Expedite, Padre Pio, Anthony of Paduma, Ann, St Nicholas, St. Martha, St John Baptist, St. Christopher, Teresa of Calcutta, Catherine of Alexadria, Bernard of Clairvoix, Joseph: Please Bless, protect, provide, guide, answer my prayers ASAP, heal, help improve in abundance V, all of Victoria’s votive light petitions, V’s DM petitions, V’s HS Sodality petitions, V’s OMP Pet, SU, MH, OSST TL, V’s Pry Pkt & dly offg pet pkt bag all of them, Grmr Petitions, rosary, Mass, novena, Eucharistic Adoration petitions, written petitions and daily offering prayer packet intentions for the last 7 months please answer all petitions safely tucked inside quickly & in abundances. Better position, better health, employment, temporal and spiritual favors, home, legal needs,sppts, Special Intentions, Special Petitions Mary and St Joesphs Intentions swap, pry pkt, special petitions and daily offerings pkt, employment, happy secure stable healthy future marriage-children-motherhood, safe travels throughout the year, special intentions & petitions, special intention, aged, Mary and St Joseph’s intentions swap, sick-needy-poor-dying-disabledi, financial favors and blessings, put on the mind of Christ, put the mind of Jesus Christ, emotional healings, financial healings, Bky favors, tax favors, SL LC lgl/at/dsbi/tr/sf favors sp pts, spiritual healings, mental healings, good luck and good fortune, peace prosperity and happiness in USA, souls in purgatory, successful operation, safe travel all modes, keeping me free from all violent satanical demonic legal tax financial deceitful harm filled with Precious Blood of Jesus Christ, career fvrs and blessings, 20/20 vision, success in business and completion of God’s Ministry, peace in the family and all my relationships i, peace of mind, home blessing, car blessing, healing. Temps in my community 56-72 year round with mild tranquil low humidity weather happiness and peace all across USA. Please answer all of the prayers for others, Victoria, in reparation for my sin and sin in the World, conversion of sinners, end to abortion, Pro-Life Morals and Values in USA, and Holy souls in purgatory. In Wheeling WV, WV, USA, and World-wide. special intentions. Glory be, etc. For the Love, honor, and glory of the Infant of Prague, Our Lady of Sorrows, Sacred Heart of Jesus, Immaculate Heart of Mary, St Joseph, St. Expedite, St. Pio, St. Ann, my own Guardian Angel, Arch Angels Michael-Gabriel-Raphael and all other Holy Angels, Jesus our Eucharistic Lord, and Holy Face of Jesus Christ. Amen.​
Al aire libre
May the Precious Blood of Jesus Christ continue to bless protect guide provide in abundance all of us in all of our spiritual and temporal needs. Especially the needy, poor, sick, disabled, and dyingii. Amen.​

Pres Blood Jesus, ItPg, HlSpt, HFJ, JKAN, Jesus EchLrd SHJ IHM, OLL, OLF, OLV, OLG, OLGC, OLGR, OLGS, OLMM, OLMC, Jesus Divine Physician, OLS all Holy men & wmn in hvn & earth, all Grdn Arch Seraph & Cherub Power Thrones Virtues Prcnplties Dominion Angels Sts Pio, Athy, Expd, Jsph, Ann, More, Christr, Paul, Bosco, Lucy, Mcl Gbrl Rphl, Dyn, Rita, Thrs Lsx, MG, Nicls, BslJohn Bapt, Mta, TA, JA, Peter, Luke, 3 kings wise men, Mthw, Mark, John, Isdr(s) CthAlx,Clare, Arch Bishop Fulton Sheen, Mother Angelica, Bishop Schmitt, all of my deceased family members, all holy men and women in heaven and on earth, MG. Faustina, my dead Mom, all souls in purgatory, Frncs Assisii & Jude Please adopt Victoria as your spiritual child pray for V si & all of Vs intentions, Bless pour out blsgs protect provide guide heal replenish prtz fv hghst & best for V V improve in abdc Victoria all of V’s intentions, all of V’s: income, prosperity in every ways, hdilglcsiiiiifslpdmihidtgrpppsficpidrpsimowhphiriiiisiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiifiivsiiiiiiiiiclrty fv siihealings, special intentions, home, level headedness, clarity, understanding, peace, calm, love, car, btrhth & btrptn, career, purity, chastity, mdi, stability, security, special intentions, peace of mind and body, love, children’s books, bkcntiedsi spgrtnsiagent, publr, understanding, faith, hope, joy, self control, provide for all of my needs just for today Jesus and keep me from stain of sin just for today, peace in my families and godly relationships, peace in V community WV USA and on earth, special intentions, ccqfii fv, love, joy, peace, sii,k love, sii, godliness temporal legal dating career professional personal financial retirement car cmm fix V car affordably agent attny’s md healing publisher safe travel krggsutgc apt insptc storage rmnt prtytx lcsi si wrtg childrens Chrstn books sltxi emplymnti si good luck good fortune prosperity sfawatntsisi rep ed hlgsi vlpi si dci happy unions sisi car love si drpcpisi ihriivpskncrhrcrsimticrbblkrclalniiiiiiiiiihphihlwiiiii fv and mercies si, mowi dshfrtcmptr iiiiihredhlw btr health and healings si spg rtn ex sltxirsntltrs bkcy tmprl se lsk hlthins hp si dsb&dsbmn si siifv ii,si, hdfslpdmaaazmfi favors mercies si, love, godly real siii friends family church community stii Special Intentions & Petitions, safe travel, mindfulness, siiiiifv, love, si, justicei, mercies, love, si, love, calm, love, si, gentleness, joy, peace, love, EMBSPH healings, stability, love, my guardian angel all Arch angels Saints Angels and Virgin Mary thank you and blessings, love, si, ii, love, prosperity, love, si, gentleness, sppts love, special intentions, V repiisi fv, calm, virtues I need most, siifv security, peace of mind and body, peace, happiness, car cmm rtmnt IRS TXNTLTRS sisiftr fv, love, calm, peace, dntlclng si msgigrtsii fv, sii, good fortune, prosperity, income and financial blessings, fntlcng good health and healings, goodness, kindness, peace, peace of mind and body, jsi, mercy, spclints orgz V apt lf strg siiifv, temporal legal spiritual financial income career professional personal dtg rp retirement favors, si, love, happy unions prosperity, love,siretirement favors, love, special intentions and petitions, rpnshsfvpatintdrpiedhrcrblccnpskncgssiihgi mercies favors si, thank you, frtdsintclphmfelmf favors and mercies si, self control, love, Special Intentions & Petitions, iictltng, chbkscrdtgfn to take off fvi , strengthen heal & make whole in body mind & soul V filled with PBJ V sii, dtg, Special Petitions & Intentions, cut cords not best 4 V & help V form healthy godly attachments siifv merciesi ent cpns, good luck, good fortune, self control, ovcmtp, hopesiispgtrniifv, love, reali =yoked pure chst lvg faithful Ctci cute mascln godly gentleman husband similar to St Josephi bring us tgthr on wings of Gods Angels & let him be happy about it fvii, i, clarity, happy death, happy life, heal my DAD spclintsisii sppts, Special Intentions, hope, curb V appetite raise V metabolic rate si si fv, financial blessings and favors, Special Intentinos, Special Petitons, Special Intentions, put on V full armor of God 24.7.365, Special Intentions, Special Petitions, Special Intentions, sppts, cloak V with the cloak bp of St patric 24.7.365 fv mercies, Special Intentions si, mercy, happiness, sppts, Special Intentions Special Intentions, Special Intentions, Special Intentions, Special Intentions, Special Intentions, forgiveness si, spclints, spclints spclints, love, Special intentions, peace, Special Intentions, love, V’s written petitions and daily offering prayer ministry bag candle OSST DM HSS SU OLL MH all cndlv&r si Eucharistic Adoration wrtn and oral pt OMPH TL rsy ms nvna ptns sii fv mercies si, reparation for V sin and sin in the world, healings si fv, spclints, faith, ctrl tng, sii, mindfulness, temporal and legal fv, spclintssi hlwmgcisi fv, V paperwork sii fv, Special Intentions, heal V brn cncni heck wl eyes back foot skni fv mercies V lpiiifv mercies, si, spclints, love, Souls in purgatory, si, help with a family mattersi, assistance with financial difficulties, relief from pain, freedom from depression or anxiety, MOW crtcnn fvmerciessiii, hdfslpdmimowirtiifv, special intentions and petitions, petitions, love, special intentions and petitions, peace of V’s mind and body, calm, tranquility, healings special petitions, special intentions, a return of faith, guidance for a loved one in troublesiii, help with a difficult decisions, courage in the face of adversity or uncertainties, improved health, btrpsn, hope and inspirations, body and spiritual well beings, a grateful heart, love special intentions and petitions, special intentions and petitions, special intentions and peittions and petitions and petitions and petitions, love, Special intentions, V’s happy healthy godly stable secure grace filled fti marriage home/married careers children retmnt life sii fv, love, temporal favors, peace, spclints spclints, si, love, sii,retirement bkcy gciifv awcbiskncrntathredazhlwdsftclphncmptreddrpinssfmf fv krggsutand cmm, V’s written petitions & daily offering prayer ministry bag DM SU HSS 13 OSST OMPH OLL wrtn & oral Erst Adstntli pts rsy msn nv pry tlpry prycrcl crcl lght& all cdlptsi God answer all prayers tucked inside quickly special Intentions, put on V armor of God spclints fv, temporal & spiritual favors, love, special intentions, new ec car grt wnty grt gs mlg special intentions cmptr, love, prosperity, spclints, Special Intentions & Petitons, Pettions, Special Intentions, Special Intentions & Pts, V’s healthy happy peaceful wlpdiso pure chaste kind simple evdyisecure stablei calm loving proprs sii mild gntli Ctc dtg wlpdcri sac married home family prg motherhood children dtv mrg retmnt si life siiisiiii fv, Special Intentions, Special Petitions, Special Intentions, Jesus mold V into who V is to be for God, graces V needs most, goodness, Special Intentions, spclints lglg aty fv mercesisii fv, dtvctnsi spptsi fv, real siicl moral value based ii friends family husband like ST Joseph md attnys agent publisher emplyrsii church community apt cmplx inlwi stii bkcyiii aptbldii ent associates siiii car md hi ci fvrs mercies sii fv, love, love, peace, sii cmm cpnsi krgrgsut fvi siifv, special intentions fv, love, si seisiiiifv, heal end the idle chatter of V mind fv, si, healings, happiness, joy, si, spclints, find Vs nitch, love spclintssiifv, love sptsspclints, mldns hp love spclints, sfiifv, peace & joy, calm, gnlns, love, peace of mind & body, Special Intentions, real isi moral value based sii friends family prof hlrs agent emplyr publisher community church apt car hi rtmnt ins careers bs hlth hlgs pry sts md attnys sti hrs ci inl chi mscln cutei chtci stable secure pure chaste faithful gentleman husband similar to St Jsphi fv mercies siiifv, Special Petitions, mindfulness, orgzgi sii fv, sppts, Special Intentions & Petitions, isltxntltrsidmiihdfslpmdhihpii fvi, love, si, stability security si peace, spclints, cloak V w/ the cloak of St Patrick’s breas*plate & SI, 20/20 vision, Special Intentions, happy unions, love i thanksgivings, reparation for sin, souls in purgy, curb V appetite and raise V metabolism fv, healings, help V eat 1000 calories per day burn 400 per day in exercises lose inches fat and lbs eat high protein high fiber high veggies and high fruit no refine sugar lactose free very little carbohydrates sppts fv, best daily routine for V sppts, fv, divine timing, IRS SL TX NTLTRS SI favors, love, provide for all of my needs just for today Lord and keep me from stain of sin just for today, love, ctrl tongue, spg/rtn fv, love, edkrggsutcarcmmdtgcciiut fv and gc si fv, special intentions, 10 commandments in our homes churches schools businesses government and USA sii fv, love, temporal and spiritual favors, love, peace, peace of mind, jsi, justicei, mercy, spclints and petitions, dsfrtgsintmf fv, love, special intentionsi, healing of the Catholic church and all of its members sii fv, special intentions, purity in USA and the Catholic church and its members fv, love, peace, spclints fv, ctrl tongue, faith hope clarity fv, gentleness, gifts and fruits of the Holy Spirit, God bless & provide for all of the poors in V community WV and USA end the poors low self worths in USA sii fv mercies siiii, mercy, joy, happiness, calm & peace in our homes USA & earth, shptrtnsinwfsiMary & St Josephs ints swap, love hope sii fv, V’s chidlrens books sttxntli fn si peace hope joy btr health & healings btr ptsn career dtg to take off fv, a new economy car great warranty and gas milage sii fv for V, love, jsi, mercies, siiifv, love, calm, mercy, sii, curb V apt rs V mtb help V lose inches lbs fat V eat high prtn high frbv frst frt frsvgt hihg vg no refn sugar very low carbs sisi fv, good luck sii , organze V apt dec V aptisiii vlplskipeace, jsi, siii, professional and personal favors, heal strengthen and make whole in body mind and soul V JJIi KQi DMDi SJIi RIi RTITMISFI TAi JCI CGI SIIii iiispgrtnexfv stgfv love sisifv, fvi, special intentions, control of tongue, sppts, contacts I need sii fv, sppts, krggsutfrtgc fv, sppts, love, safe travel for V JJi SJI and all in WV USA and on earth mercies and favors si, my car to pass inspection prty tx frtxi health insurance apt insiii hlw aaa z mfi fv mercies si, clarity, love, special intentions, love, car washes gc fv, oil change gc favors, car repairs gc favors, ed gc favors i, spclints, spclintsi, God bless V’s Spring Summer Fall Winter & holidays sp, carpoolingsii, spclints, fsii sppti fv, sppts, love, V godly si emplymnt siifv si, sei, keep V & SISIfree from all bodily mental legal demonic satanical financial health harm filled with the Prs Bld Jesus Christ 24.7.365, purity, chastity, peace, innocence, modestyii, positivityi, confidencei, spclints, si, bodily and spiritual healings for all in need of healing in WV and USA merciesi, special intentions, peace in my own familiy and all families in USA, love, spclints, overcome temptations, self control, sii, stability, security, calm, sppts, prosperity, deliverance, restoration, good news si, special intentions, pro life sii, sptns, love, joy, end the chatter of the mindi, si, calm, love, ppi, prosperity sii fv, spptsi, love, si, kindness, spclints, love, spclintsi, love, sppts, special intentions, special intentions, love, sell my silver car sii fv, si, si, cool crisp safe Godly kind modest healthy stable secure pure chaste Christian Catholic sii Spring Summer Fall in V community siiii fv, close door fast on what and who I don’t need in my own life or that’s just not the best for me and more good happy best for meiii people places ideas things income friends family career husband like St Joseph I need that is most pleasing to God in my own life be obvious to me sii fv, heal my memory fv, sppts, heal everyone’s memories in USA favors, healings, btr health btr pstn, sppts, best daily routine and divine timing for V siipp sptstemporal and spiritual favors, better health and healings, btpstn, love and calm, spclints, best daily routine for V sii fv, spclints, love, keep V free from all mental emotional dctfl stncl dmnc bodily acdntl lgl ih fncl career prof harm filled with the Precious Blood of Jesus Christ, si, financial blessings and favors, si Special Intentions, my beloved asleep in Jesus Christ relatives si souls mercies sii, stability, security, financial security and financial stability, peace, love, self control, spclints, my car and apartment God’s blessings and protection, spclints, spclints, love, divine timing and divine order, spclints and pts, desire of the two hearts, thank you’s, my own guardian angel STs Michael Gabriel Raphael all Cherubim Seraph Arch Powers Thrones Dominions all Holy Angels and Saints and Mary thank you for your intercessory prayers, Special Petitions, Special Intentions, Sprcial Intentions deiverance peace restoration, Special Intentions Special Intentions, love, calm, sp, love, calm, piety, sii fear of God knowledge goodness faithfulness gni si, virtues and graces I need most, love, spclints, spclints, love, spclints, peace, give V and SJ Godly relationships si fv, finances and income all needs and obligations met with ease and some left over fvrs sptsii fv, 20/20 vision back neck brn foot spnifn lg dt healings fv, love, hope, mercy, understanding, good counsel, wisdom, si, V’s childrens Christian books dating monies careers to be blessed by God and take off to good success, good success in every area of V’s life, contacts and people I need siiiiiiiiiiiiiiiiii fv, spclints, purity, chastity, spptsifv, legal financial temporal sprtl career car favors mercies, love, Special Intentions, Special Intentions, Special Intentions, si, childlike, make me a child of GOD SI, innocence for V SJ and all in USA mercies, peace, love, graces and fruits of the Holy Spirit fv, si, love, prudence, fortitude, knowledge, spclints, joy, God mold V into who V is to be for GOD, spclints, frtdscpt clphni fv, mercies, love, help me to eat healthy si fv, clarity, spclints, love, hope, calm, si, 20/20 vision, heal V back brn foot fn mnst sltx dtg car lgl bkcy siii lf si fv merciesi, love, si, clearing, grounding, gentleness, peace, Special inecial intentions & Petitions special intentions, heal the chatter of V mind sii fv mercies, love, special intentions, keep the worm away from V that eats up V’s monies finances health rgodly relationships money income crsi life sii fv mercies, love, special intentions, strengthn heal make whole in body mind and soul Victoria JJI KQ TA DM RT SII SJI and all in WV and USA siii fv mercies, temporal lg bk sltxntiihdfslpdmihphirptn awdrpiiiivpiifrtclpnsiaptntiatii hlg hpns stbt scrt peace of mind and body car cmm cpns ent dtg divine timing siiii fv mercies, faith, hope, peace of mind and body, love, hhbii, love, heal my DAD and SJ SP and V fv mercies sii, confidence, sell 7,000 books per year sii fv, spclintsi, special intentions special intentions, wisdom, holy fearsi, fear of the Lord, si, stability, security, peace, temperance, purity, modesty, sii, love, organize V apt dec V apt strg V apt sii fv, special intentions, love, spclints, love, help me to earn money and respect for and with my godgiven skills in a godly environment and supervisor sii fv mercies, special intentions, love, splints, love, find V nitch, graces V needs most God mold V into who V is to be for Christ, healings, joy, faith, hope,pregnancy motherhood vns car hi gentleman =ykd husband like ST Joseph sii fv mercies real for V siii mrlvlbs friends fmay agent emplyrsi state gv apt community church inlws md attys publisher ins spkrsbs cmtry hlrs profs bs cmntysi fmiiiii hsbd=ykd lk St Josphiifv mercies siifv, fix V car computer sii fv, sii fv, love, calm, tranquility, siiifv, paid monies and respect for my god given skills talents siifvk kcut cords not best for V help V form healthy holy attachments plsg to Jesus and best for V sii fv, love, peace on earth, joy, happiness, love, siifv, keep V free from all physical violent bodily mental demonic financial rpn crs dtg si ill health dctfl harm filled with the prs bld Jesusi fv, sii fv, love, sii, desire of the two hearts, love, peace, si love, si bless my apt car projects plans careers health income monies finanices rep iat all times fv mercy goodness love faith hope kindness gentleness peace si vllskiii, put mind of Christ on all in WV USA and on earth fv, sii help V de clutter organize siii new frntrs storage organizing si book shelves cabinet washer/dryer si computer internet TV clphn sii V retirment fv mercies sii, V and SJ relief from all pain fv, love, V’s happy healthy peaceful kind secure stable pp practical every day pure chaste moral value based real Catholic wlpdii Christian dating careers wlpd sacramental marriage home family love, si, purity chastity sifv, put mind of Christ on V JJI SJ SII all in V community WV & USA & on earth sii 24.7.365, Svtn for all USA & WW, sptsi, mildness, meekness, si, confidence, peace, spclintsifv, heal V memory and all peoples memories in WV USA and on earth favors siiii fv, conversions, one man one woman sacramental Catholic marriage in WV USA and on earth fv mercies, si, Special Intentions, spclintsii, special intentions & 72 degrees & peace in Vs cmty yrrnd burn out ending all Stns pomps & works evlspts neg evil ints hoG violence greed gossip meanspts ngi revenge skg false idols storms cancer adctns na snsofflsh mugging dstrctvns dstcn si vandelism pride impurity coveting envy jls stgsx&flptsi si evlintigdlsn na wlns dpi macho crs hxs pulling the rug out sii discords opprsg the poors anger actsw of fury wild wtchcrt abtn euthenasia lust roving eyesi disasters dope hmls in need poverty rrdg undrmg hhigh heat and humidity emotional abuse immaturity childishness pride impurity paganism false idols dense spirits of destructions darkness worldliness homelessness si secular prngy prstn allergies asthma toxins heart attacks strokes cancer lnlnsii flsprnflpnii negativity tepidnesssi wrath avarice malice greed obnicity in sinsi indifference ingratitude presumptionsi despairsi sodomysi insct to the wage earnersi spclints, si, greed, childishness, immaturityi, emotional abuse, si, dprsn, bp, sppts mri si fci effeminacy taking advantage of the poorsi lsei melancholy cold/flu sz si impurity dpn pranks ice/snow silightening I hvy & frzg rn black ice si drnks drkdrg tension si thieves of hope si meanness si insolence indifference ingratitude jzblsi ldgoni splints iii dns sifv, plsrdtg/plsrmrg mntlilns siii lsei anger bickering sof sabotage rrdg scdi I poverty secular wmbs macho na wldns stnsm one upping bltg si floods every storms sp paganism sins sbth splints personnapping spts spells bwtcmt si mean jokes flns frsi floodsi brkini fighting dmscabsi arguing bickering mugging vandalism ancestoral crs si grudge si ssa CthcPrsn mri fci collisions spclnts doai cold/flu al/asma gdlns poverty randy instability promiscuity promiscuous outfits ego eimisibiha demons nervous/mental/emotional disorders hatred of God wmbs special intentions muggings spclints pulling rug out accidents si bitterness flirting worldliness paganism pride impurity spcls ssa spclints adultery affairs emotional abuse immaturity childishness despair si tension competition rivalries oppressing the poorsi pranks suffering of the oppressedsi sins on the sabbath si wlvsi taking advantage of the poorsi si wanting to get someones secular scientificism unversalism si disasters I idestruction frsi brkn wldns na iiibearing false witness vain glory splt plyby/plygrl mntltyliving spp sins of the flesh carnality greed secular tension muscle tension worldliness godlessness si shootings stabbings si superiority complex no moral compassi gangs sppts ldgon leading astray si wmbs deadly sin poverty cptn prctni rlvrsii opprsg poors curses hexes ancestoral curses blindness eimisibipiha in need addictions hatred of God depression dementia collisions rape pmr abortion culture of death asistend suicide depression hyper anger rrdg undermining wanting to GET hurt somones opprsg the poors gossip swearing rnki relativism disasters storms ice/snow/allergies asthma si drugs violence guns/weapons despair flhpflsprncprncsi false idols envy jealousy sins of the flesh scantily clad women and men macho jzblsi ssa ssm relativisms leading astray ll si fci hexes curses ancestoral curses sii promiscuity one upping mean spireitedness prygi drunk driving pretentiousi murmmering goading personnapping se*trafficking prostitution lswii mocking blygi Christian Catholic persecutionsi bp anxiety blygi macho si hmwrkrs secular lsei gltnyi sugar and carb addictions drunkenness hschnsi ha trblmkgi se*pots/fleshpots disasters destruction melancholy ax bp mri fci si rp drgs spw es crs hxs heresy si cmptn dprsn alcoholicism un4gvnsii pranks childishness revenge seeking greed si culture of death si mpcii familiarty btwn se*esii ax bp sii all various storms Red Dragon grudges unrepentance si coveting si ill will Anti Christ bewitchment spells false idols sins on the sabbath envy jealousy lust paesi sii, bslphmyi heresyi indifference carnality sins of the flesh insolence high heat humidity si sii chaos si atheism universalism scientificismsi quarrels si Cthc prsctn grudges rrdg undermining sbtgs prtg mrmrg dpi back biting sxl rvltn sii impurity ptsd scl axty sii addictions brg glswtnsii one upping stabbings violence si curses gvg flststmyi covetting plsrskgi eimisibipiha si doai Catholic persecutionsii poverty indifference ingratitude si chpns sii ego siii in V community state of WV USA wwi V fmly frds SJIII for honor of Infant of Prague Holy Face of Jesus and Jesus King of all Nations Our Lady of Sorrows Immaculate Virgin Mary Our Father, etc Hail Mary, etc Glory be, etc. Sptcis​

Pres Bld Jesus, Infant of Prague, Jesus Eucharistic Lord, Jesus Dvn Physician, Holy Spirit, all Guardian Seraph Cherubim & Arch Angels, & Holy Face Jesus JKAN, OLS OLGC OLGS OLGR OLMM OLMC OLF OLV, Sts Pio Anthony Expedite Ann Joseph Cthn Alxdra Jude Rita Paul Bosco Christopher MG TA Joan of Arc Dymphna Benedict Francis Assisi Lucy Scholastica Clare please adopt V as your spiritual child pray for V & all of V’s intentions; bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity peace love childrens books sltxntlrsirsi, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, reparation for V sins & sin,, peace on earth, special intentions & petitions, strengthen heal make whole in body mind & soul V JJi DJi RTi KQi DMDii TAi SJI & all in USAii, keep V free from all bodily mental emotional mental stncl dmnc dctfl financial brp careers dtg harm filled with the Prs Bld Jesus Christ, God bless V’s income monies & finances all needs sii & obligations met w/ left over sii in abdc stability, security, special intentios, love, special intentions, thanksgivings, spclints, love, si, prosperity, calm, wisdom, understanding, clarity, V and SJ relief from all pain, hope and inspiration, safe travel mercies for all in USA and on earth, put the mind of Christ on V JJI SJ and all in WV USA and on earth fv, love, sii, hope and inspiration, temporal lgl lglcs bky txiii mliiifv mercies, special intentions, siiifv, Jesus mold V into who V is to be for Jesus Christ, all V’s shpg rtn ex si cpns ent fvsi, special intentions, spclints love, jsi, si, hope and inspiration, sii, keep V free from all bodily mental demonic satanical deceitful fncl violent career harm filled with the prs bld Jesus Christ fv, lgl mliiisiiifvii mrcs, love, jsi, divine timing divine order, V and SJ peace of mind and body fv, level hdns, spclints, God bless Vs car fix Vs car affordably cmm gskrgrutgcii agent childrens books careers all V’s ministry’s fulfilled peace healings better ptsn better health love dating lgl bkcy sltxntlsi apt finances income dmihdfslphlwi dvn tmng dvn order sptcls edi hrmny get paid money & respect for my god given skills prkvlpstiii EMBSPH hlgs love si rtmt ent si tmprl lgli prsnl prof frt clphn cmptr fvrs mercies sii, 20/20 vision, healings, husband like ST Joseph for Victoria, love, mercy, peace, provide for my needs Lord just for today, keep me from stain of sin just for today, spclints, love spclints, conversions mercy, love, ctl of tng EMBSPH healings for V JJi SIii & all in WV & USA intss mercies, love, spclintsiiiiiiiiifv, gentleness, love, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, stability, security, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiijiiisi favors mercies, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp temps 67 with peace calm & no storms in V community year round mercies, peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride impurity storms greed coveting adultery lust taking advantage of the poors macho emotional abuse immodesty insolence indifference mugging gdlsn wkdns sii envy jlsy ingratitude arguing violence collisions cancer heart attacks strokes alhxs bwtcmt gmblg dmns drkns worldliness violence malice anger dspair wmbs sii wpns vandalism allergies bp ax sz confusion rrdg undermining opprsg the poors roving eye sins of the flesh negativity swearing false idols addictions murmering sii ssa ssm violence thieves of hope unequally yoked Cthn mrgsii, si, chldnsii imtrytsi, provocative promiscuity drkns swearing ancestoral curses glty malice greed sii no mrlcmpsi Stns pomps & works evl spirits meanspiritedness emotional abuse ax emotional/nervous/mental disorders dementia heart disease, simortal sin si i chlsnsi imtrty hnpkgi si plotting evilsi ssa ssm pmr rp secular revenge seeking curses hmls in need poverty siiin V community, WV, & USA VSJIIIIfv mercies spits special intentions.
Precious Blood Jesus, all holy men and women in heaven and on earth, Mother Angelica Bsp Schmitt Arch Bishop Fulton Sheen All Angels, all Guardian Seraph Cherubim Virtues Prnplts Dmns Thrns & Arch Angels, Our Lady Sorrows Infant of Prague JKAN Sts Pio Anthony Expdt Joseph Martha John Baptist Bndct Peter Frncs Assisi Ann MG Joan Arc Schlstca Mthw Basil More Bsco Michael Gabriel Raphael Jude Rita Dymphna Infant Prague Jesus Dvn Physician Jesus Eucharistic Lord & HFJ pls adopt V as your spiritual child pray for V and all of V’s intentions prtz bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity siii peace love childrens books careers finances moniesi sltxntlrsirsi, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & all in WV & USA mercies, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, si, V and SJ relief from all pain fv, siiifv, V’s shpg rtn ex sii fv sii cpns ent siifv, keep V free from all bodily mental emotional stncl dmnc fncls lgl cr violent dctfl harm filled with the prs bld of Jesus Christ, put the mind of Christ on all in WV USA and on Earth 365 days per year, splcintsi, return offaith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 OMPH CAMM AMM Prycrcl crlltiii SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, hope and inspiration, sii, love, spclints, thnks, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, special intentions and petitionsi stability, security, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiiijiiiisi favors mercies, balance for V si, spclintsi V ppi, kindness, return of Faith for V, conversions si, siii, si, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, prosperity, krggsutftrptyhphlthhlwaaazmsgiiiiispclints bk txiii frt clphn car cmm fv merices, siii siiiiiii, joy, return of faith, hope and inspiration, si, crisp temps 67 with low humidity peace calm & no storms in V community year round mercies, real sii moral value based sii real friends fmi church community st sii emplyr agent publisher md prof hlrs at gvtofi txi hdfslpdmimowiawshpgdrpiii apt car spg str tx apti prf prsnl edi careersii inlws si vl tii ngbrhdsii =ykd Cthl pure chaste cute fthl kind lvi afctntiii mscniiii gentleman faithful husband similar to St Joseph intsi fv mercies sii fv peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride impurity storms greed chatter of the mind tension coveting adultery lust gad sax bp sz eimisibipiha heart ache ptsdsii pain cold/flu mri anger Catholic persecutionsi fci disasters sii htg vrbl abs promiscuity blygsi no mrl cmpsi opprsg poors sfrg prs malice greed anger si promiscuous outfits and promiscuity childishnessi immaturitys fmtry btwn sxsi flrtgsi mean hard heartedness sz negativity evil intentionsi plotting evilsi drkns exi ax sad dprsn fci hyper ptsds shootings guns stabbings muggings vandalism paehsi sdmy ii chatter of the mind abortion rape culture of death imbibing vlsw hedonism jzblsprts godlessness carousing wkdns addictions sitaking advantage of the poors macho emotional abuse immodesty insolence indifference mugging ingratitude arguing Blygvi chaos gossip si grudges sii hlns ftnsii confusion instability insctyii rrdg undermining culture of death si hinderances bksii carousing violence collisions cancer heart attacks strokes meanspiritedness revenge seeking curses homelessness in need poverty in V community, WV, & USA mercies special intentions.

Precious Blood Jesus, All Angels, all Guardian & Arch Angels, OLS SHJ IHM JKAN Jesus Divine Physician Jesus Eucharistic Lord Sts Pio Anthony Ann Expedite Christopher Jude Dymphna Michael Gabriel Raphael Martha Rita Bishop Schmitt, Archbishop Fulton Sheen, Mother Angelica all souls in puragory, my mom, Faustina & HFJ bless protect provide guide heal replenish sanctify godly improve in abundance Victoria all of V’s income prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God graces V needs most find V’s nitch prosperity peace love childrens books careers finances moniesi sltxntlrsirsi, Special Intentions & petitions, good fortune, safe travel for V & all in USA, good luck btr health btr pstn overcome tptns favors, put the mind of Christ on V SI JJI and all in USA & on earth, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & all in WV & USA mercies, put on V full armor of God, calm, careers, sprtl clarity peace of mind and body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly favors/mercies siii, intentions, special intentions and petitionsi stability, security, relief from all pain for V SJ Si and all in USA and on earth sii fv merciesi, put the mind of Christ on V and all in WV USA and on earth fv, love, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiiiiiiiiiiijiiisi favors mercies, get my future gentlman husband like ST Joseph to ask me out siiiiifv, thank yous, love, joy, peace, calm, healings, happines, siii, love, love, siii, sisiiigodly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp temps 67 with low humidity peace calm & no violent storms in V community year round mercies, peace chastity purity modesty kindness love calm stability security better health & healings in our homes, USA & on earth; end all worldlines paganism pride impurity storms greed chatter of the mind tension coveting adultery lust taking advantage of the poors gad fcii wmbs Stns Pmps Wrks Evil spirits negativity evil intentionsii despair thieves of hope unequally yoked Catholic marriagesi, sii pltg evilsi, Vlswi ego, drpsn, melancholy hyper siimacho emotional abuse immodesty insolence indifference mugging ingratitude arguing violence collisions cancer heart attacks strokes meanspiritedness revenge seeking curses homelessness in need poverty siiii in V community, WV, & USA VSJIIIVFMFRIIII mercies special intentions. For honor of Infant of Prague and Holy Face of Jesus. Hail Mary, etc. Glory be, etc. spptis

Al aire libre
Precious Blood Jesus, All Angels, Our Lady Sorrows, JKAN, SHJ IHM, OMPH OLL OLGR OLGS OLV OLF OLMM OLMC Infant of Prague Jesus Eucharistic Lord Jesus Dvn Physician Sts Pio Anthony Expedite Ann Joseph Christopher Jude Rita Dymphna Martha deMontfort dominic Michael Gabriel Raphael Benedict Francis of Assisi Clare Lucy Tkkna Bishop Schmitt souls in purgatory all holy men and women in heaven and on earth all saints in heaven Arch Bishop Fulton Sheen Mother Angelica my deceased family in purgatorys Isidore(s) Paul Bosco Cthn Alxdra Faustina Mthw Basil More TL MG TA all Guardian Seraph Cherubim thrones Principalities Virtues Dominions & Arch Angels, & Holy Face Jesus bless protect provide guide heal replenish sanctify godly improve in abundance Victoria: all of V’s incomes prosperity Special Intentions Special Petitions Special Intentions iii prosperity V nwfrtriiEMBSPH hlgs Special Intentions & petitions,Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God, graces V needs most,find V’s nitch prosperity peace love childrens books careers finances moniesi lgillgsisltxntlrsirsiiiiiiii, Special Intentions & petitions, good fortune, safe travel for V & USA, good luck btr health btr pstn overcome tptns fv, put the mind of Christ on V SI JJI & all in USA & earth, love, safe travel for V JJii SJi and all in WV USA and on earth mercies, love, joy, hope, faith, gentleness, sii, help V to forgive and trust Jesus mercies, love, special intentions, help V JJIIIii SJ fulfill all ministries for God, keep V free from all mental emotional stncl dmnc violent fncl lgl bodily sk rrdg dctfl mny career rep harm filled with the Prs Bld Jesus Christ, spcli help V dnze orgzz strg si, Jesus form V into who V is to be for Jesus Christ, sell 7000 of V’s childrens Christian books per year fv mercies, love, souls in purgatory, reparation for V sin and sin in the world, hope and inspiration, si get 131 in V nminV bk acti, Vlglcs atatf mdclmliiiifviiimrcsii krggsutsiii hlpe V lose 30 pnds and inches curb V apt rs V mtc rate siiii I I i lglcsmliatiatiifv Vppkindness sispppts, siiifv, relief from all pain for V and SJ siii fv, spptsi, Mary and St Josephs intentions swapss, desire of the two heartsi, love, hlwhivrthpiiiiiiiiiiiiicrplgiiiiiiiiiaaazhdfslpdmmowawfrtdshaptcarrepsltdlglatatfbkcymdprfprsnlagtpblssprlslvtbtrhlthhlgsvpdrpiidrpcpiiicmptrclphnsisiedinwfwdiiiiifv mercies si, hhbi, love, strengthen heal make whole in body mind and soul V and SJ fv mercies sii fv, clarity, understanding, si, love, siiiiifv, 20/20 vision for V JJ i and all surgery fees if needs and surgery blessed and provided sifv, love, joy, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, help with a difficult decision, relief from pain, assistance with financial difficulties, well being in body & spirit, hope & inspiration, freedom from anxiety depression pi, a greatful heart empluii favors, special intentions, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & WV & USA mercies, put on V full armor of God, calm, careers, innocence back 4 V SI & all in USA 24/7, sprtl clarity peace of mind & body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS MH 13 OMPH CAMM SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly fv/mercies siii, intentions, special intentions and petitionsi stability, security, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt iiifavors mercies, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp 65 degrees low humidity and peace in V cmnty year rnd mercies, peace chastity purity modesty kindness love calm stability security better health & healings for V, USA & on earth; end all worldlines paganism pride impurity storms greed chatter of the mind tension coveting adultery lust taking advantage of poors thieves of hopes macho emotional abuse immodesty insolence indifference jzbls sins of the flesh ego scientificism universalism rrdg undermining sbtgs leading astray wmbs abortion euthanasia collisions ptsds bp ax sz eimisibisiha greed opprsg the poors sfrgs of the opprsds si homelsns in needs anger violence weapons drnkns drugs wkdns coveting vainglory envy jealousy sii plsrdrg/plsrmrg plsrski hmwrkrs dprsn melancholy oneupping gossip ylg prtyg si Catholic persecutions thieves of hopes addictions gangs mri fci rape ssa ssm ice/snow blk ice thunder lightening stns pmps works ii swrg prghy prmscty prmscdrgs & bhvr imtryi chlsdnsi clwnhsevl sprts dmns hexes spells secular ancstrl crs si extra mrtl afrs si gdlsn prgphy collisionsextreme heat mugging ingratitude arguing violence collisions cancer heart attacks strokes meanspirit revenge seeking curses poverty sii in V community, WV, & USA siiion earth simercies special intentions. For honor Infant Prague & Holy Face Jesus Hail Mary, etc Glory be, etc. si

Precious Blood Jesus, All Angels, all Guardian Cherubs Seraph Virtues Thrones Prncpltis Dominions & Arch Angels, & Holy Face Jesus JKAN OLS SHJ IHM OMPH OLL OLGR OLMM OLMC OLGS SHJ IHM Jesus Eucharistic Lord Jesus Dvnn Physician Sts Pio Anthony Expedite Ann Joseph Chrtphr Basil More Michael Gabriel Raphael Jude Rita Mtw Cthn Alxdra Patrick Faustina BrndtSbrs Tknka Lucy Frncs Assisi Arch Bishop Fltn Sheen Mother Angelica Bishop Schmitt all souls in purgatory si all holy souls in purgatory Dymphna Martha John Baptist Bosco Pope John Paul Mthr Theresa Calcutta Jochium Paul bless protect provide guide heal replenish sanctify godly improve in abundance Victoria: all of V’s incomes prosperity Special Intentions Special Petitions Special Intentions EMBSPH hlgs Special Intentions & pts, calm, tranquiliity siiiiiiiiiiipetitions,Special Intentions Special Intentions mercy jsi God mold V into who V is to be for God, graces V needs most,find V’s nitch prosperity peace love childrens books careers finances moniesi lgillgsisltxntlrsirsiiiii, Special Intentions & petitions, souls in purgatory, reparation for sin, Mary & St Joseph swapsi, love joy, financieal blessings and favors, Special intentionsii, love, sii, keep V free from all bodily mental stncl dmnc dctfl violent lgl dstr career fncl rep car apt siiemtl nrvs physical hlth sk harm filled with the prs Bld Jesus Christ, financial and income blessings for V let all of V’s needs and obligations be met wtih so much left over monthly siiiiiiiiiiifv mercies, siii, good fortune, safe travel for V & USA, good luck btr health btr pstn overcome tptns fv, put the mind of Christ on V SI JJI & all in USA & earth, self control, provide for my needs Lord just for today, keep me from stain of sin just for today, help with a difficult decision, relief from pain, assistance with financial difficulties, well being in body & spirit, hope & inspiration, freedom from anxiety depression pi, a greatful heart empluii favors, special intentions, mercy, love, control of tongue, EMBSPH healings for V JJi SIii & WV & USA mercies, put on V full armor of God, calm, careers, spclints and petitions clnlflnclphiifv, innocence back 4 V SI & all in USA 24/7, sprtl clarity peace of mind & body, agent, publisher, healings, joy, hope, faith, love, V’s wrtn pts & dly ofrg pry mnsty bag DM HSS 13 OMPH CAMM SU OSST Vprytl Adtn cndl pts siii fv, dating & temporal fv, godly pure chaste mscln cute classy igntlm faithful husband lkstJii for Victoria bring us together on the wings of Gods Holy Angels quickly fv/mercies siii, intentions, special intentions and petitionsi stability, security, calm, love, prosperity, gentleness, tranquility, calm bkcy car cmm apt finances lgl rtrmnt hdfslpdmhlwmowhphicigslgliiiiiiiiiiiiiiiiiiiiiiijiiiiiiisi favors mercies, innocence for all in WV VSJ and USA then on earth return for Jesus Christ for all no matter what the age fv, heal our memories Jesus only healthy holy memories from now on sii fv, si, return of faith, txii bkcy i fv mercies siiifv more good pleasing to God people places ideas incomes wlpdcrs hsbd lk St Joseph I need that pls God and less people places Idesas things I don’t need or that are not as pleasing to GOD in my own life be obvious to me siifv, spclintsiifv, mercies, relief of pain for V and SJ fv, keep V free from all violnet mental emotional nervous fncl demonic satanical deceitful lgl rrdg ft career dtg harm filled with the Prs Bld Jesus Christ, sii, godly employmentsii special intentions favors mercies, love, God bless the poors in WV & USA& end the poorsii in WV & USA low self worth, crisp 65 degrees low humidity in V cmnty year rnd mercies, peace chastity purity modesty kindness love calm stability security better health & healings for V, USA & on earth; end all worldlines paganism pride impurity storms greed chatter of the mind tension coveting adultery malice gossip envy jealousies sii chldnsi imtrtysi Satans pomps and works thieves of hope evil spirits ego negativiesi sii insolence indifference ingratitude jzblsptrs bitterness promiscuity wmbs lust taking advantage of poors macho emotional abuse immodesty insolence indifference carousing wkdns sins of the flesh sii eimisibiha leadinga astray sii unequally yoked Catholic marriagesii Vlswi ego greed grvsn chatter of the mind gltny si plsrmrgplrdtplrcrldtg carousing abortion culture of death si ii fcii bewitchment witchcraft sii hyper ax ptsds mugging demons evil spirits plotting evilsi tensions mugging ingratitude arguing violence collisions cancer heart attacks strokes meanspirit revenge seeking curses poverty siiiiii iin V community, VSJIIIII WV, & USA mercies special intentions.

Al aire libre
Prs bld Jesus, ItPg, HlSpt, HFJ, JKAN, Jesus EchLrd SHJ IHM, OLL, OLF, OLV, OLG, OLGC, OLGR, OLGS, OLMM, OLMC, Jesus DvnPhysn, OLS all Holy men & wmn in hvn & earth, all Grdn Arch Seraph & Cherub Angels Sts Pio, Athy, Expd, Jsph, Ann, More, Christr, Paul, Bosco, Lucy, Mcl Gbrl Rphl, Dyn, Rita, Thrs Lsx, MG, Nicls, BslJohn Bapt, Mta, TA, JA, Peter, Luke, Mthw, Mark, John, Isdr(s) CthAlx,Clare, Frncs Assisii & Jude Please adopt Victoria as your sprtlchd pray for V si & all of Vs intentions, Bless pour out blsgs protect provide guide heal rpnsh prtz fv hghst & best for V V iprv in abdc V all of V’s intentions, all of V’s: income, prosperity in every ways, hdfslpdmihidtgrpppsficpidrpsimowhphiriiiisiiiiiiiiifiiv clrty fv siihealings, special intentions, home, lvl hdns, clarity, undrstg, peace, calm, love, car, btrhth & btrptn, career, purity, chastity, mdi, stability, security, peace of mind &body, love, children’s books, bkcntiedsi spgrtnsiagent, publr,, faith, hope, joy, self control, provide for all of my needs just for today Jesus and keep me from stain of sin just for today, special intentions, ccqfii fv, godliness temporal legal dating career professional personal financial retirement car cmm fix V bkprvd$iagent attny’s md healing publisher safe travel krggsutgc apt insptc storage rmnt prtytx lcsi si wrtg childrens Chrstn books sltxi emplymnti si good luck good fortune prosperity sfawatntsisi rep ed hlgsi vlpi si dci happy unions sisi car love si drpcpisi ihriivpskncrhrcrsimticrbblkrclalni fv and mercies si, mowi dshfrtcmptr hredhlw btr health and healings si spg rtn ex sltxirsntltrs bkcy tmprl se lsk hlthins hp si dsb&dsbmn si siifv ii,si, hdfslpdmaaazmfi favors mercies si, godly real siii friends family church community stii Special Intentions & Petitions, safe travel, mindfulness, siiiiifv, love, si, justicei, mercies, love, si, love, calm, love, si, gentleness, joy, peace, love, EMBSPH healings, stability, love, gentleness, sppts love, special intentions, V repiisi fv, calm, virtues I need most, siifv security, peace of mind and body, peace, happiness, car cmm rtmnt IRS TXNTLTRS sisiftr fv, love, calm, peace, dntlclng si msgigrtsii fv, sii, good fortune, prosperity, income and financial blessings, fntlcng good health and healings, goodness, kindness, peace, peace of mind and body, jsi, mercy, spclints orgz V apt lf strg siiifv, temporal legal spiritual financial income career professional personal dtg rp retirement favors, si, love, happy unions prosperity, love,siretirement favors, love, special intentions and petitions, rpnshsfvpatintdrpiedhrcrblccnpskncgssiihgi mercies favors si, thank you, frtdsintclphmfelmf favors and mercies si, self control, love, Special Intentions & Petitions, iictltng, chbkscrdtgfn to take off fvi , strengthen heal & make whole in body mind & soul V filled with PBJ V sii, dtg, Special Petitions & Intentions, cut cords not best 4 V & help V form healthy godly attachments siifv merciesi ent cpns, good luck, good fortune, self control, ovcmtp, hopesiispgtrniifv, love, reali =yoked pure chst lvg faithful Ctci cute mascln godly gentleman husband similar to St Josephi bring us tgthr on wings of Gods Angels & let him be happy about it fvii, i, clarity, happy death, happy life, heal my DAD spclintsisii sppts, Special Intentions, hope, curb V appetite raise V metabolic rate si si fv, financial blessings and favors, Special Intentinos, Special Petitons, Special Intentions, purt on V full armor of God 24.7.365, Special Intentions, Special Petitions, Special Intentions, sppts, cloak V with the cloak bp of St patric 24.7.365 fv mercies, Special Intentions si, mercy, happiness, sppts, Special Intentions Special Intentions, Special Intentions, Special Intentions, Special Intentions, Special Intentions, forgiveness si, spclints, spclints spclints, love, Special intentions, peace, Special Intentions, V’s written petitions and daily offering prayer ministry bag candle OSST DM HSS SU OLL Eucharistic Adoration wrtn and oral pt OMPH TL rsy ms nvna ptns sii fv mercies si, reparation for V sin and sin in the world, healings si fv, spclints, faith, ctrl tng, sii, mindfulness, temporal and legal fv, spclintssi hlwmgcisi fv, V paperwork sii fv, Special Intentions, heal V brn cncni heck wl eyes back foot skni fv mercies V lpiiifv mercies, si, Souls in purgatory, si, Special intentions, V’s happy healthy godly stable secure grace filled fti marriage home/married careers children retmnt life sii fv, love, temporal favors, peace, spclints spclints, si, love, sii,retirement bkcy gciifv awcbiskncrntathredazhlwdsftclphncmptreddrpinssfmf fv krggsutand cmm, V’s written petitions & daily offering prayer ministry bag DM SU HSS 13 OSST OMPH OLL wrtn & oral Erst Adstntli pts rsy msn nv pry tlpry prycrcl crcl lght& all cdlptsi God answer all prayers tucked inside quickly special Intentions, put on V armor of God spclints fv, temporal & spiritual favors, love, special intentions, new ec car grt wnty grt gs mlg special intentions cmptr, love, prosperity, spclints, Special Intentions & Petitons, Pettions, Special Intentions, Special Intentions & Pts, V’s healthy happy peaceful wlpdiso pure chaste kind simple evdyisecure stablei calm loving proprs sii mild gntli Ctc dtg wlpdcri sac married home family prg motherhood children dtv mrg retmnt si life siiii fv, Special Intentions, Special Petitions, Special Intentions, Jesus mold V into who V is to be for God, graces V needs most, goodness, Special Intentions, spclints lglg aty fv mercesisii fv, dtvctnsi spptsi fv, heal end the idle chatter of V mind fv, si, healings, happiness, joy, si, spclints, find Vs nitch, love spclintssiifv, love sptsspclints, mldns hp love spclints, sfiifv, peace & joy, calm, gnlns, love, peace of mind & body, Special Intentions, real isi moral value based sii friends family prof hlrs agent emplyr publisher community church apt car hi rtmnt ins careers bs hlth hlgs pry sts md attnys sti hrs ci inl chi mscln cutei chtci stable secure pure chaste faithful gentleman husband similar to St Jsphi fv mercies siiifv, Special Petitions, mindfulness, orgzgi sii fv, sppts, Special Intentions & Petitions, isltxntltrsidmiihdfslpmdhihpii fvi, love, si, stability security si peace, spclints, cloak V w/ the cloak of St Patrick’s breas*plate & SI, 20/20 vision, Special Intentions, happy unions, love i thanksgivings, reparation for sin, souls in purgy, curb V appetite and raise V metabolism fv, healings, help V eat 1000 calories per day burn 400 per day in exercises lose inches fat and lbs eat high protein high fiber high veggies and high fruit no refine sugar lactose free very little carbohydrates sppts fv, best daily routine for V sppts, fv, divine timing, IRS SL TX NTLTRS SI favors, love, provide for all of my needs just for today Lord and keep me from stain of sin just for today, love, ctrl tongue, spg/rtn fv, love, edkrggsutcarcmmdtgcciiut fv and gc si fv, special intentions, 10 commandments in our homes churches schools businesses government and USA sii fv, love, temporal and spiritual favors, love, peace, peace of mind, jsi, justicei, mercy, spclints and petitions, dsfrtgsintmf fv, love, special intentionsi, healing of the Catholic church and all of its members sii fv, special intentions, purity in USA and the Catholic church and its members fv, love, peace, spclints fv, ctrl tongue, faith hope clarity fv, gentleness, gifts and fruits of the Holy Spirit, mercy, joy, happiness, calm & peace in our homes USA & earth, shptrtnsinwfsiMary & St Josephs ints swap, love hope sii fv, V’s chidlrens books sttxntli fn si peace hope joy btr health & healings btr ptsn career dtg to take off fv, a new economy car great warranty and gas milage sii fv for V, love, jsi, mercies, siiifv, love, calm, mercy, peace, jsi, siii, professional and personal favors, heal strengthen and make whole in body mind and soul V JJIi KQi DMDi SJIi RTITMISFI TAi JCI CGI SIIii iiispgrtnexfv stgfv love sisifv, fvi, special intentions, control of tongue, sppts, contacts I need sii fv, sppts, krggsutfrtgc fv, sppts, love, safe travel for V JJi SJI and all in WV USA and on earth mercies and favors si, my car to pass inspection prty tx frtxi health insurance apt insiii hlw aaa z mfi fv mercies si, clarity, love, special intentions, love, car washes gc fv, oil change gc favors, car repairs gc favors, ed gc favors i, spclints, spclintsi, God bless V’s Spring Summer Fall Winter & holidays sp, carpoolingsii, spclints, fsii sppti fv, sppts, love, V godly si emplymnt siifv si, sei, keep V & SISIfree from all bodily mental legal demonic satanical financial health harm filled with the Prs Bld Jesus Christ 24.7.365, purity, chastity, peace, innocence, modestyii, positivityi, confidencei, spclints, si, bodily and spiritual healings for all in need of healing in WV and USA merciesi, special intentions, peace in my own familiy and all families in USA, love, spclints, overcome temptations, self control, sii, stability, security, calm, sppts, prosperity, deliverance, restoration, good news si, special intentions, pro life sii, sptns, love, joy, kindness, spclints, love, spclintsi, love, sppts, special intentions, special intentions, love, close door fast on what and who I don’t need in my own life or that’s just not the best for me and more good happy best for me people places ideas things income friends family career husband like St Joseph I need that is most pleasing to God in my own life be obvious to me sii fv, heal my memory fv, sppts, heal everyone’s memories in USA favors, healings, btr health btr pstn, sppts, best daily routine and divine timing for V siipp sptstemporal and spiritual favors, better health and healings, btpstn, love and calm, spclints, best daily routine for V sii fv, spclints, love, keep V free from all mental emotional dctfl stncl dmnc bodily acdntl lgl ih fncl career prof harm filled with the Precious Blood of Jesus Christ, si, financial blessings and favors, si Special Intentions, my beloved asleep in Jesus Christ relatives si souls mercies sii, stability, security, financial security and financial stability, peace, love, self control, spclints, my car and apartment God’s blessings and protection, spclints, spclints, love, divine timing and divine order, spclints and pts, desire of the two hearts, thank you’s, my own guardian angel STs Michael Gabriel Raphael all Cherubim Seraph Arch Powers Thrones Dominions all Holy Angels and Saints and Mary thank you for your intercessory prayers, Special Petitions, Special Intentions, Sprcial Intentions deiverance peace restoration, Special Intentions Special Intentions, love, calm, sp, love, calm, piety, sii fear of God knowledge goodness faithfulness gni si, virtues and graces I need most, love, spclints, spclints, love, spclints, peace, give V and SJ Godly relationships si fv, finances and income all needs and obligations met with ease and some left over fvrs sptsii fv, 20/20 vision back neck brn foot spnifn lg dt healings fv, love, hope, mercy, understanding, good counsel, wisdom, si, V’s childrens Christian books dating monies careers to be blessed by God and take off to good success, good success in every area of V’s life, contacts and people I need si fv, spclints, purity, chastity, spptsifv, legal financial temporal sprtl career car favors mercies, love, Special Intentions, Special Intentions, Special Intentions, si, childlike, make me a child of GOD SI, innocence for V SJ and all in USA mercies, peace, love, graces and fruits of the Holy Spirit fv, si, love, prudence, fortitude, knowledge, spclints, joy, God mold V into who V is to be for GOD, spclints, frtdscpt clphni fv, mercies, help me to eat healthy si fv, clarity, spclints, love, hope, calm, si, 20/20 vision, heal V back brn foot fn mnst sltx dtg car lgl bkcy siii lf si fv merciesi, love, si, clearing, grounding, gentleness, peace, faith, hope, peace of mind and body, heal my DAD and SJ SP and V fv mercies sii, confidence, sell 7,000 books per year sii fv, spclintsi, special intentions special intentions, wisdom, holy fearsi, fear of the Lord, si, stability, security, peace, temperance, purity, modesty, sii, love, organize V apt dec V apt strg V apt sii fv, special intentions, love, spclints, love, help me to earn money and respect for and with my godgiven skills in a godly environment and supervisor sii fv mercies, special intentions, love, splints, love, find V nitch, graces V needs most God mold V into who V is to be for Christ, healings, joy, faith, hope, si, purity chastity sifv, put mind of Christ on V JJI SJ SII all in V community WV & USA & on earth sii 24.7.365, Svtn for all USA & WW, sptsi, mildness, meekness, si, confidence, peace, spclintsifv, heal V memory and all peoples memories in WV USA and on earth favors siiii fv, conversions, one man one woman sacramental Catholic marriage in WV USA and on earth fv mercies, si, Special Intentions, spclintsii, special intentions & 72 degrees & peace in Vs cmty yrrnd burn out ending all Stns pomps & works evlspts neg evil ints hoG violence greed gossip meanspts ngi revenge skg false idols storms cancer adctns na snsofflsh mugging dstrctvns dstcn si vandelism pride impurity coveting envy jls stgsx&flptsi si evlintigdlsn na wlns dpi macho crs hxs pulling the rug out sii discords opprsg the poors anger actsw of fury wild wtchcrt abtn euthenasia lust roving eyesi disasters dope hmls in need poverty rrdg undrmg emotional abuse immaturity childishness pride impurity paganism false idols dense spirits of destructions darkness worldliness homelessness si secular prngy prstn allergies asthma toxins heart attacks strokes cancer lnlnsii flsprnflpnii negativity tepidnesssi wrath avarice greed obnicity in sinsi indifference ingratitude presumptionsi despairsi sodomysi insct to the wage earnersi spclints, si, greed, childishness, immaturityi, emotional abuse, si, dprsn, bp, sppts mri si fci effeminacy taking advantage of the poorsi lsei melancholy cold/flu sz si impurity dpn pranks ice/snow silightening I hvy & frzg rn black ice si drnks drkdrg tension si thieves of hope si meanness si insolence indifference ingratitude jzblsi ldgoni splints iii dns sifv, plsrdtg/plsrmrg mntlilns siii lsei anger bickering sof sabotage rrdg scdi I poverty secular wmbs macho na wldns stnsm one upping bltg si floods every storms sp paganism sins sbth splints personnapping spts spells bwtcmt si mean jokes flns frsi floodsi brkini fighting dmscabsi arguing bickering mugging vandalism ancestoral crs si grudge si ssa CthcPrsn mri fci collisions spclnts doai cold/flu al/asma gdlns poverty randy instability promiscuity promiscuous outfits ego eimisibiha demons nervous/mental/emotional disorders hatred of God wmbs special intentions muggings spclints pulling rug out accidents si bitterness flirting worldliness paganism pride impurity spcls ssa spclints adultery affairs emotional abuse immaturity childishness despair si tension competition rivalries oppressing the poorsi pranks suffering of the oppressedsi sins on the sabbath si wlvsi taking advantage of the poorsi si wanting to get someones secular scientificism unversalism si disasters I idestruction frsi brkn wldns na iiibearing false witness vain glory splt plyby/plygrl mntltyliving spp sins of the flesh carnality greed secular tension muscle tension worldliness godlessness si shootings stabbings si superiority complex no moral compassi gangs sppts ldgon leading astray si wmbs deadly sin poverty cptn prctni rlvrsii opprsg poors curses hexes ancestoral curses blindness eimisibipiha in need addictions thieves of hope hatred of God depression bp anxiety blygi macho si hmwrkrs secular lsei gltnyi sugar and carb addictions drunkenness hschnsi ha trblmkgi se*pots/fleshpots disasters destruction melancholy ax bp mri fci si rp drgs spw es crs hxs heresy si cmptn dprsn alcoholicism pranks childishness revenge seeking greed si culture of death si mpcii familiarty btwn se*esii ax bp sii all various storms Red Dragon grudges unrepentance si coveting si ill will Anti Christ bewitchment spells false idols sins on the sabbath envy jealousy lust paesi sii, bslphmyi heresyi indifference scienticism universalism carnality sins of the flesh insolence stabbings violence si curses gvg flststmyi covetting plsrskgi eimisibipiha si doai Catholic persecutionsi poverty indifference ingratitude si chpns sii ego siiii in V community state of WV USA wwi V fmly frds SJIII for honor of Infant of Prague Holy Face of Jesus and Jesus King of all Nations Our Lady of Sorrows Immaculate Virgin Mary Our Father, etc Hail Mary, etc Glory be, etc. Sptcisi

Al aire libre
Al aire libre
Al aire libre

Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre

Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre

Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre

Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre
Al aire libre